spacer

EBI Dbfetch

ID   AY057816; SV 1; linear; genomic DNA; STD; ROD; 1145 BP.
XX
AC   AY057816;
XX
DT   04-FEB-2002 (Rel. 70, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus minutoides cytochrome b (Cytb) gene, complete cds; mitochondrial gene
DE   for mitochondrial product.
XX
KW   .
XX
OS   Mus minutoides (Southern African pygmy mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Nannomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1145
RX   DOI; 10.1080/10635150290069878.
RX   PUBMED; 12079642.
RA   Lundrigan B.L., Jansa S.A., Tucker P.K.;
RT   "Phylogenetic relationships in the genus mus, based on paternally,
RT   maternally, and biparentally inherited characters";
RL   Syst. Biol. 51(3):410-431(2002).
XX
RN   [2]
RP   1-1145
RA   Lundrigan B.L., Jansa S.A., Tucker P.K.;
RT   ;
RL   Submitted (27-SEP-2001) to the INSDC.
RL   Museum of Zoology and Department of Biology, University of Michigan, Ann
RL   Arbor, MI 48109-1079, USA
XX
DR   MD5; ed6db1cd54d5e464e49edbeb911c2c86.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1145
FT                   /organism="Mus minutoides"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10105"
FT   CDS             1..1145
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:1144..1145,aa:TERM)
FT                   /gene="Cytb"
FT                   /product="cytochrome b"
FT                   /note="TAA stop codon is completed by the addition of 3' A
FT                   residues to the mRNA"
FT                   /db_xref="GOA:Q8WA40"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WA40"
FT                   /protein_id="AAL23826.1"
FT                   /translation="MTIMRKTHPLFKMINHSFIDLPTPSNISSWWNFGSLLGICLMVQI
FT                   LTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYVGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILIMLLFLMTLVLFFPDMLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPFLHTSKQRNLMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPVAGIIEDKLLKLYP"
XX
SQ   Sequence 1145 BP; 345 A; 314 C; 147 G; 339 T; 0 other;
     atgacaatca tacgaaaaac acacccacta ttcaaaataa ttaaccactc cttcatcgat        60
     ctgcccaccc cttccaacat ttcatcatga tgaaactttg gatctctatt aggaatctgc       120
     cttatagttc aaatcctcac aggcctgttc ctagcaatac actatacatc agacacaata       180
     acagccttct catcagtaac acacatctgc cgagatgtaa actatggatg actaatccga       240
     tacttacatg ccaacggagc ctctatattc tttatctgct tatttttaca cgtaggacgg       300
     ggaatgtact atggatccta cacatttata gaaacatgaa atattggggt tatcttactg       360
     tttgcagtga tagccacagc atttatgggt tatgtcctcc catgggggca gatatcattt       420
     tgaggggcta cagtaattac aaaccttcta tcagccattc catatgtagg aactacccta       480
     gtagaatgaa tttgaggcgg attctcagta gacaaagcca ccctaacccg attttttgct       540
     ttccacttca tcctgccatt cattattgca gcattagtaa ttgttcacct ccttttcctt       600
     cacgaaacgg gatctaacaa ccccaccggc cttaactctg atgccgacaa aatcccattc       660
     cacccttact ataccatcaa agacatccta ggaatcctaa ttatactcct ctttcttata       720
     accttagtcc tcttcttccc agacatatta ggtgaccccg acaattatac accagccaac       780
     ccactaaaca ctccacctca tattaagcca gaatggtatt tcttatttgc atatgctatt       840
     ctacgctcaa tccccaataa actaggagga gttctagccc taattttatc tattttaatt       900
     ctagcatttc tcccattcct ccacacatcc aaacaacgaa acctaatatt ccgcccaatc       960
     acccaaaccc tatactgaat tctagtagcc aacctactaa tcctcacttg aattggaggt      1020
     caaccagtag aacacccatt catcattatt ggacaactag cctccatctc ttacttctct      1080
     attatcctta ttctaatacc agtcgcaggt atcattgaag acaaattact aaaactctac      1140
     ccatg                                                                  1145
//


spacer
spacer