spacer

EBI Dbfetch

ID   AH011356; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011356; AY057398-AY057399;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*0801 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Tait B., Cantwell L., Diviney M., Boyle A., Oliver D., Kanaan C.,
RA   Holdsworth R.;
RT   "New HLA-B*081 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Tait B., Cantwell L., Diviney M., Boyle A., Oliver D., Kanaan C.,
RA   Holdsworth R.;
RT   ;
RL   Submitted (26-SEP-2001) to the INSDC.
RL   VTIS, Australian Red Cross Blood Service - Victoria, C/O 2nd Floor, Rotary
RL   Bone Marrow Research Centre, Royal Parade, Parkville, Melbourne, Vic 3050,
RL   Australia
XX
CC   On or before Jul 6, 2011 this sequence version replaced
CC   gi:18146575, gi:18146576, gi:18146574.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8WLS9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLS9"
FT                   /protein_id="AAL59418.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRVSLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 173 C; 191 G; 69 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer