Dbfetch

ID   AY050214; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY050214;
XX
DT   05-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1406 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gans C.P., Hurley C.K.;
RT   "Novel HLA-DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Gans C.P., Hurley C.K.;
RT   ;
RL   Submitted (03-AUG-2001) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; fd5f8c9c1fc79bec7b452975c5cb1548.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="GN0407"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95HK4"
FT                   /db_xref="IMGT/HLA:DRB1*14:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HK4"
FT                   /protein_id="AAL23553.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//