spacer

EBI Dbfetch

ID   AY050209; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AY050209;
XX
DT   05-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1405 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Gans C.P., Hurley C.K.;
RT   "Novel HLA-DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Gans C.P., Hurley C.K.;
RT   ;
RL   Submitted (03-AUG-2001) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 0f46815566ccec3767c1845f4b1130d6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00402"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95HK7"
FT                   /db_xref="IMGT/HLA:DRB1*14:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HK7"
FT                   /protein_id="AAL23550.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 269 BP; 56 A; 63 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcga                                         269
//


spacer
spacer