spacer

EBI Dbfetch

ID   AY048687; SV 1; linear; genomic DNA; STD; HUM; 419 BP.
XX
AC   AY048687;
XX
DT   15-OCT-2001 (Rel. 69, Created)
DT   27-JUL-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-419
RX   DOI; 10.1111/j.0001-2815.2004.00282.x.
RX   PUBMED; 15304013.
RA   Chen Z.X., Tsan S.G., Dang C.W., Chu C.C., Lin M., Lee Y.J.;
RT   "Identification of two new HLA-DRB1 alleles: HLA-DRB1*1350 and
RT   DRB1*140502";
RL   Tissue Antigens 64(3):300-303(2004).
XX
RN   [2]
RP   1-419
RA   Tsan S.G., Chu C.-C., Lin M., Lee Y.-J.;
RT   "A new HLA-DRB1*11 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-419
RA   Tsan S.G., Chu C.-C., Lin M., Lee Y.-J.;
RT   ;
RL   Submitted (27-JUL-2001) to the INSDC.
RL   Departments of Pediatrics and Medical Research, Mackay Memorial Hospital,
RL   92, Sec 2, Chung-San N Rd, Taipei 10449, Taiwan
XX
DR   MD5; dff9c30d6898f970a3c64d10f6eae7ba.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..419
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>419
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT   mRNA            <112..>381
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT   CDS             <112..>381
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:50:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAL12226.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            112..381
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /number=2
XX
SQ   Sequence 419 BP; 76 A; 111 C; 152 G; 80 T; 0 other;
     gttaaggttc ccagtgcccg cacccggccc agggagcccc ggatggcggc gtcactgtca        60
     gtgtcttctc aggaggccgc ctgtgtgact ggatcgttcg tgtccccaca gcacgtttct       120
     tggagtactc tacgtctgag tgtcatttct tcaatgggac ggagcgggtg cggttcctgg       180
     acagatactt ctataaccaa gaggagaacg tgcgcttcga cagcgacgtg ggggagttcc       240
     gggcggtgac ggagctgggg cggcctgatg ccgagtactg gaacagccag aaggacttcc       300
     tggaagacag gcgggccgcg gtggacacct actgcagaca caactacggg gttggtgaga       360
     gcttcacagt gcagcggcga ggtgagcgcg gcgcggggcg gggcctgagt ccctgtgag        419
//


spacer
spacer