spacer

EBI Dbfetch

ID   AH011128; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011128; AY045737-AY045738;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1801 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Bennett T.T., Luis A.D., Cavett J.W., Bardet W., Sidebottom D.A.,
RA   Pruett B.N.;
RT   "SBT of HLA B Class I";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Bennett T.T., Luis A.D., Cavett J.W., Bardet W., Sidebottom D.A.,
RA   Pruett B.N.;
RT   ;
RL   Submitted (13-JUL-2001) to the INSDC.
RL   Microbiology, University of Oklahoma Health Sciences Center, 975 NE 10th St
RL   BRC 317, Oklahoma City, OK 73104, USA
XX
RN   [3]
RP   371-646
RA   Bennett T.T., Luis A.D., Cavett J.W., Bardet W., Sidebottom D.A.,
RA   Pruett B.N., Hildebrand W.H.;
RT   ;
RL   Submitted (13-JUL-2001) to the INSDC.
RL   Microbiology, University of Oklahoma Health Sciences Center, 975 NE 10th St
RL   BRC 317, Oklahoma City, OK 73104, USA
XX
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000479203; homo_sapiens.
XX
CC   On or before Jul 6, 2011 this sequence version replaced
CC   gi:18140157, gi:18140158, gi:18140156.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8WLT1"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLT1"
FT                   /protein_id="AAL10683.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 177 C; 189 G; 69 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta cagagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer