spacer

EBI Dbfetch

ID   AY043181; SV 1; linear; genomic DNA; STD; HUM; 398 BP.
XX
AC   AY043181;
XX
DT   02-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0902 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-398
RX   DOI; 10.1046/j.1365-2370.2002.00312.x.
RX   PUBMED; 12121280.
RA   Lin J., Liu Z.H., Chen W., Jia Z., Pan D., Fu Y., Zhang F., Xu A.;
RT   "A novel DRB1*09 allelic sequence in the Jing ethnic minority of China";
RL   Eur. J. Immunogenet. 29(4):335-336(2002).
XX
RN   [2]
RP   1-398
RA   Lin J., Liu Z., Chen W., Jia Z., Pan D., Fu Y., Zhang F., Xu A.;
RT   ;
RL   Submitted (29-JUN-2001) to the INSDC.
RL   Biochemistry, Zhongshan(Sun Yat-sen) University, #135 West of Xingang Road,
RL   Guangzhou, Guangdong 510275, P.R. China
XX
DR   MD5; cf609c14964711caa5a8e7e47264d82e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..398
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>398
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0902"
FT   mRNA            <70..>339
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0902"
FT                   /product="MHC class II antigen"
FT   CDS             <70..>339
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0902"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8MGZ9"
FT                   /db_xref="IMGT/HLA:DRB1*09:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ9"
FT                   /protein_id="AAK81687.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            70..339
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0902"
FT                   /number=2
XX
SQ   Sequence 398 BP; 77 A; 92 C; 150 G; 79 T; 0 other;
     atggtggcgt ctctgttagt gtcttccccg gaggccgccc ctgtgaccgg atccttcgtg        60
     tccccacagc acgtttcttg aagcaggata agtttgagtg tcatttcttc aacgggacgg       120
     agcgggtgcg gtatctgcac agaggcatct ataaccaaga ggagaacgtg cgcttcgaca       180
     gcgacgtggg ggagtaccgg gcggtgacgg agctggggcg gcctgacgct gagtactgga       240
     acagccagaa ggacttcctg gagcggaggc gggccgaggt ggacaccgtg tgcagacaca       300
     actacggggt tggtgagagc ttcacagtgc agaggcgagg taagcatggt ggggggcggg       360
     gcctgggtcc ctgtgaactg ggaatctgag tgtgtgtg                               398
//


spacer
spacer