spacer

EBI Dbfetch

ID   AY042679; SV 1; linear; genomic DNA; STD; HUM; 284 BP.
XX
AC   AY042679;
XX
DT   30-AUG-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DBR3) gene, HLA-DBR3*0209 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-284
RA   Li L., Hurley C.K.;
RT   "Novel HLA*DRB3 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-284
RA   Li L., Hurley C.K.;
RT   ;
RL   Submitted (21-JUN-2001) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; a77fe12a2f37f5bf6efad7eacc732120.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..284
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00394"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <21..>284
FT                   /gene="HLA-DBR3"
FT                   /product="MHC class II antigen"
FT   exon            21..284
FT                   /gene="HLA-DBR3"
FT                   /number=2
FT   CDS             <21..>284
FT                   /codon_start=1
FT                   /gene="HLA-DBR3"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*01:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAK94514.1"
FT                   /translation="RFLELRKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQR"
XX
SQ   Sequence 284 BP; 57 A; 71 C; 103 G; 53 T; 0 other;
     tccttcgtgt acccgcagca cgtttcttgg agctgcgtaa gtctgagtgt catttcttca        60
     atgggacgga gcgggtgcgg ttcctggaga gacacttcca taaccaggag gagtacgcgc       120
     gcttcgacag cgacgtgggg gagtaccggg cggtgacgga gctggggcgg cctgtcgccg       180
     agtcctggaa cagccagaag gacctcctgg agcagaagcg gggccgggtg gacaattact       240
     gcagacacaa ctacggggtt ggtgagagct tcacagtgca gcgg                        284
//


spacer
spacer