Dbfetch

ID   AY039682; SV 1; linear; mRNA; STD; HUM; 741 BP.
XX
AC   AY039682;
XX
DT   12-FEB-2002 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens retinoic acid early transcript 1 (RAET1L) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-741
RX   DOI; 10.1006/geno.2001.6673.
RX   PUBMED; 11827464.
RA   Radosavljevic M., Cuillerier B., Wilson M.J., Clement O., Wicker S.,
RA   Gilfillan S., Beck S., Trowsdale J., Bahram S.;
RT   "A cluster of ten novel MHC class I related genes on human chromosome
RT   6q24.2-q25.3";
RL   Genomics 79(1):114-123(2002).
XX
RN   [2]
RP   1-741
RA   Wicker S., Wanner V., Radosavljevic M., Bahram S.;
RT   ;
RL   Submitted (12-JUN-2001) to the INSDC.
RL   Centre de Recherche d'Immunologie et d'Hematologie, Faculte de Medecine, 4
RL   rue Kirschleger, Strasbourg 67085, France
XX
DR   MD5; 18eafbb245103ab604c7a7955a8087e6.
DR   Ensembl-Gn; ENSG00000155918; homo_sapiens.
DR   Ensembl-Tr; ENST00000286380; homo_sapiens.
DR   Ensembl-Tr; ENST00000367341; homo_sapiens.
DR   EuropePMC; PMC5356570; 27655680.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..741
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q24.1-q25.1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..741
FT                   /codon_start=1
FT                   /gene="RAET1L"
FT                   /product="retinoic acid early transcript 1"
FT                   /note="A03"
FT                   /db_xref="GOA:Q5VY80"
FT                   /db_xref="H-InvDB:HIT000083592.14"
FT                   /db_xref="HGNC:HGNC:16798"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:4S0U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5VY80"
FT                   /protein_id="AAK91503.1"
FT                   /translation="MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRP
FT                   GPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQ
FT                   LLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHP
FT                   GARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQL
FT                   RATATTLILCCLLIILPCFILPGI"
XX
SQ   Sequence 741 BP; 186 A; 212 C; 184 G; 159 T; 0 other;
     atggcagcag ccgccatccc agctttgctt ctgtgcctcc cgcttctgtt cctgctgttc        60
     ggctggtccc gggctaggcg agacgaccct cactctcttt gctatgacat caccgtcatc       120
     cctaagttca gacctggacc acggtggtgt gcggttcaag gccaggtgga tgaaaagact       180
     tttcttcact atgactgtgg caacaagaca gtcacacccg tcagtcccct ggggaagaaa       240
     ctaaatgtca caacggcctg gaaagcacag aacccagtac tgagagaggt ggtggacata       300
     cttacagagc aactgcttga cattcagctg gagaattaca cacccaagga acccctcacc       360
     ctgcaggcaa ggatgtcttg tgagcagaaa gctgaaggac acagcagtgg atcttggcag       420
     ttcagtatcg atggacagac cttcctactc tttgactcag agaagagaat gtggacaacg       480
     gttcatcctg gagccagaaa gatgaaagaa aagtgggaga atgacaagga tgtggccatg       540
     tccttccatt acatctcaat gggagactgc ataggatggc ttgaggactt cttgatgggc       600
     atggacagca ccctggagcc aagtgcagga gcaccactcg ccatgtcctc aggcacaacc       660
     caactcaggg ccacagccac caccctcatc ctttgctgcc tcctcatcat cctcccctgc       720
     ttcatcctcc ctggcatctg a                                                 741
//