spacer

EBI Dbfetch

ID   AY038075; SV 1; linear; genomic DNA; STD; HUM; 967 BP.
XX
AC   AY038075;
XX
DT   17-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-967
RA   Grams S.E., Begovich A.B., Oksenberg J.;
RT   "One new HLA-A allele";
RL   Unpublished.
XX
RN   [2]
RP   1-967
RA   Grams S.E., Begovich A.B., Oksenberg J.;
RT   ;
RL   Submitted (05-JUN-2001) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Ave., Alameda, CA
RL   94501, USA
XX
DR   MD5; 75a1fc567f5264884eaa929841ef8795.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..967
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            181..450
FT                   /gene="HLA-A"
FT                   /number=2
FT   mRNA            join(<181..450,692..>967)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<181..450,692..>967)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IE8"
FT                   /db_xref="IMGT/HLA:A*24:32"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IE8"
FT                   /protein_id="AAK71476.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRESLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            692..967
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 967 BP; 169 A; 312 C; 357 G; 129 T; 0 other;
     cctcgtcctg ctactctcgg gggccctggc cctgacccag acctgggcag gtgagtgcgg        60
     ggtcgggagg gaaacggcct ctgcggggag aagcaagggg cccgcctggc gggggcgcaa       120
     gacccgggaa gccgcgccgg gaggagggtc gggcgggtct cagccactcc tcgtccccag       180
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc       240
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       300
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       360
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagagc ctgcggatcg       420
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       480
     cgacccctca tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac       540
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg       600
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg       660
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc       720
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       780
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       840
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       900
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       960
     cgcacgg                                                                 967
//


spacer
spacer