Dbfetch

ID   AY036907; SV 1; linear; genomic DNA; STD; HUM; 340 BP.
XX
AC   AY036907;
XX
DT   03-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04032 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-340
RA   Greville W.D.;
RT   "HLA-DRB1*04032 extended sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-340
RA   Greville W.D.;
RT   ;
RL   Submitted (28-MAY-2001) to the INSDC.
RL   Molecular Genetic Lab, Tissue Typing Services, Australian Red Cross Blood
RL   Service, 153 Clarence street, Sydney, NSW 2000, Australia
XX
DR   MD5; 4fa339efe3e00f7c049dd255dac1ba3a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..340
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            34..303
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <34..>303
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <34..>303
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IF0"
FT                   /db_xref="IMGT/HLA:DRB1*04:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IF0"
FT                   /protein_id="AAK67648.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 340 BP; 67 A; 86 C; 124 G; 63 T; 0 other;
     gcttctgtaa ccggatcgtt cttgtccccc cagcacgttt cttggagcag gttaaacatg        60
     agtgtcattt cttcaacggg acggagcggg tgcggttcct ggacagatac ttctatcacc       120
     aagaggagta cgtgcgcttc gacagcgacg tgggggagta ccgggcggtg acggagctgg       180
     ggcggcctga cgctgagtac tggaacagcc agaaggacct cctggagcag aggcgggccg       240
     aggtggacac ctactgcaga cacaactacg gggttgtgga gagcttcaca gtgcagcggc       300
     gaggtgagcg cggcgcgggg cggggcctga gtccctgtga                             340
//