spacer

EBI Dbfetch

ID   AY034875; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY034875;
XX
DT   19-JUN-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0108 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2002.590421.x.
RX   PUBMED; 12135442.
RA   Martinez-Gallo M., Martinez-Lostao L., Martinez-Carretero M.A., Gago I.,
RA   Maroto P., Rodriguez-Sanchez J.L., de la Calle-Martin O.;
RT   "Identification of a novel HLA-DRB1 allele, DRB1*0108, by sequence-based
RT   DRB typing in two siblings";
RL   Tissue Antigens 59(4):350-351(2002).
XX
RN   [2]
RP   1-270
RA   de la Calle-Martin O., Martinez-Gallo M.;
RT   ;
RL   Submitted (15-MAY-2001) to the INSDC.
RL   Immunology, Hospital Sant Pau, Pare Claret 167, Barcelona 08025, Spain
XX
DR   MD5; 61d5dcf063749dc154e6652d3e4d7e92.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IF1"
FT                   /db_xref="IMGT/HLA:DRB1*01:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IF1"
FT                   /protein_id="AAK61607.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 61 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer