spacer

EBI Dbfetch

ID   AY033428; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY033428;
XX
DT   01-JUN-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Oh E., Sheldon M.H., Dunn P.;
RT   "A new DRB1*12 allele identified in a Korean sample";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Oh E., Sheldon M.H., Dunn P.;
RT   ;
RL   Submitted (25-APR-2001) to the INSDC.
RL   R&D, Dynal Biotech Ltd, 11 Bassendale Road, Bromborough, Wirral CH62 3QL,
RL   UK
XX
DR   MD5; 815724c8eb112b495b022693ee9f03a3.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="AAK55114.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
XX
SQ   Sequence 270 BP; 54 A; 68 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer