Dbfetch

ID   AH010728; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH010728; AY033293-AY033294;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2002.590417.x.
RX   PUBMED; 12135438.
RA   Grams S.E., Moonsamy P.V., Mano C., Oksenberg J.R., Begovich A.B.;
RT   "Two new HLA-B alleles, B*4422 and B*4704, identified in a study of
RT   families with autoimmunity";
RL   Tissue Antigens 59(4):338-340(2002).
XX
RN   [2]
RP   1-646
RA   Grams S.E., Begovich A.B., Oksenberg J.;
RT   ;
RL   Submitted (24-APR-2001) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Ave., Alameda, CA
RL   94501, USA
XX
DR   MD5; 14742222c480ebf61916c14159b72c56.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:14009356, gi:14009357, gi:14009355.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IY5"
FT                   /protein_id="AAK50379.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B variant"
FT                   /number=2
FT                   /note="similar to allele HLA-B*44021"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B variant"
FT                   /number=3
FT                   /note="similar to allele HLA-B*2701"
XX
SQ   Sequence 646 BP; 114 A; 174 C; 187 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagaat atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//