Dbfetch

ID   AY033075; SV 1; linear; genomic DNA; STD; HUM; 257 BP.
XX
AC   AY033075;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPBI) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-257
RX   DOI; 10.1111/j.0001-2815.2004.00198.x.
RX   PUBMED; 15140044.
RA   Lapi S., Curcio M., Fornaciari S., Mariotti M.L., Isola P., Bonci F.,
RA   Pistello M., Scatena F.;
RT   "Identification of a novel HLA-DPB1 allele, DPB1*9701, by sequence-based
RT   typing";
RL   Tissue Antigens 63(6):606-608(2004).
XX
RN   [2]
RP   1-257
RA   Lapi S., Curcio M., Italia S., Rizzo G.;
RT   "Identification of a novel DPB1 allele by sequence based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-257
RA   Lapi S., Curcio M.;
RT   ;
RL   Submitted (23-APR-2001) to the INSDC.
RL   Laboratory of Immunogenetics, S. Chiara Hospital, Via Roma 57, Pisa 56125,
RL   Italy
XX
DR   MD5; 6fb34ccdc82f11974df458b61c41adcb.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..257
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>257
FT                   /gene="HLA-DPBI"
FT   mRNA            <1..>257
FT                   /gene="HLA-DPBI"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>257
FT                   /codon_start=3
FT                   /gene="HLA-DPBI"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*97:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAK51161.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVWEFRAVTE
FT                   LGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQ"
XX
SQ   Sequence 257 BP; 61 A; 62 C; 94 G; 40 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagc tcgtgcgctt cgacagcgac gtgtgggagt       120
     tccgggcggt gacggagctg gggcggcctg aggcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgcag                                                      257
//