spacer

EBI Dbfetch

ID   AY029777; SV 1; linear; genomic DNA; STD; HUM; 394 BP.
XX
AC   AY029777;
XX
DT   05-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-394
RA   Varney M.D., Rossi V.;
RT   "A Novel DPB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-394
RA   Varney M.D., Rossi V.;
RT   ;
RL   Submitted (11-APR-2001) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, Australian Red Cross
RL   Blood Service, C/o Royal Melbourne Hospital, Grattan St, Parkville 3050,
RL   Australia
XX
DR   MD5; 478b0d9c88bc75f2e3f1321ca486f35e.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..394
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            8..271
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   mRNA            <8..>271
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <8..>271
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*91:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAK40344.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDLLEEKRAVPDRMCRHNYELDEAVTLQRR"
XX
SQ   Sequence 394 BP; 80 A; 101 C; 155 G; 58 T; 0 other;
     cccgcagaga attacgtgca ccagttacgg caggaatgct acgcgtttaa tgggacacag        60
     cgcttcctgg agagatacat ctacaaccgg gaggagttcg tgcgcttcga cagcgacgtg       120
     ggggagttcc gggcggtgac ggagctgggg cggcctgatg aggactactg gaacagccag       180
     aaggacctcc tggaggagaa gcgggcagtg ccggacagga tgtgcagaca caactacgag       240
     ctggacgagg ccgtgaccct gcagcgccga ggtgagtgag ggctttgggc cggcggtccc       300
     agggcagccc cgcgggcccg tgcccagggc gcaggagcag ccgggttggc ctaagggacc       360
     ttagtgccgg gcggaaaggg gactttgggt tggg                                   394
//


spacer
spacer