spacer

EBI Dbfetch

ID   AH010613; SV 2; linear; genomic DNA; STD; HUM; 625 BP.
XX
AC   AH010613; AY028516-AY028517;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0801 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-625
RX   DOI; 10.1034/j.1399-0039.2002.590111.x.
RX   PUBMED; 11972881.
RA   Greville W.D., Dunckley H.;
RT   "Identification of sequence errors in HLA-DRB1*0801 and HLA-DRB1*12011";
RL   Tissue Antigens 59(1):52-54(2002).
XX
RN   [2]
RP   1-625
RA   Greville W.D.;
RT   ;
RL   Submitted (07-MAR-2001) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13641396, gi:13641397, gi:13641395.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..625
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BM9"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>625
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0801"
FT   mRNA            join(<1..270,371..>625)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0801"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>625)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0801"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q30134"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30134"
FT                   /protein_id="AAK31609.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPS"
FT   exon            <1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0801"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>625
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0801"
FT                   /number=3
XX
SQ   Sequence 625 BP; 116 A; 131 C; 171 G; 107 T; 100 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcg                                             625
//


spacer
spacer