spacer

EBI Dbfetch

ID   AY026349; SV 1; linear; genomic DNA; STD; HUM; 271 BP.
XX
AC   AY026349;
XX
DT   04-DEC-2002 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*06new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-271
RA   Casamitjana N., Gil J., Campos E., Santos M., Nogues N., Ribera A.,
RA   Palou E.;
RT   "Identification of a new DQB1*06 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-271
RA   Casamitjana N., Gil J., Campos E., Santos M., Nogues N., Ribera A.,
RA   Palou E.;
RT   ;
RL   Submitted (30-JAN-2001) to the INSDC.
RL   Immunohematologia, Centre de Transfusio i Banc de Teixits, PG. Vall
RL   d'Hebron 119-129, Barcelona 08035, Spain
XX
DR   MD5; 1c09fec1529a3a8b107381eb1ac86e68.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..271
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>271
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>271
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAK01944.1"
FT                   /translation="EDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRA
FT                   VTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVAFRGILQRR"
FT   exon            1..271
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 271 BP; 60 A; 64 C; 100 G; 47 T; 0 other;
     gaggatttcg tgtaccagtt taagggcatg tgctacttca ccaacgggac ggagcgcgtg        60
     cgtcttgtaa ccagatacat ctataaccga gaggagtacg cgcgcttcga cagcgacgtg       120
     ggggtgtacc gggcggtgac gccgcagggg cggcctgttg ccgagtactg gaacagccag       180
     aaggaagtcc tggagaggac ccgggcggag ttggacacgg tgtgcagaca caactacgag       240
     gtggcgttcc gcgggatctt gcagaggaga g                                      271
//


spacer
spacer