spacer

EBI Dbfetch

ID   AH010665; SV 2; linear; genomic DNA; STD; HUM; 643 BP.
XX
AC   AH010665; AY016213-AY016214;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4501 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-643
RX   DOI; 10.1034/j.1399-0039.2003.00095.x.
RX   PUBMED; 12956882.
RA   Steiner N.K., Gans C., Baldassarre L., Bradshaw D., Rizzo M., Divekar S.,
RA   Koester R., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Twenty-five novel HLA-B alleles";
RL   Tissue Antigens 62(3):263-266(2003).
XX
RN   [2]
RP   1-643
RA   Baldassarre L.A., Hurley C.K.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [3]
RP   1-643
RA   Baldassarre L.A., Hurley C.K.;
RT   ;
RL   Submitted (12-DEC-2000) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road NW,
RL   Washington, DC 20007, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13793982, gi:13793983, gi:13793981.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..643
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00387"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>643
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT   mRNA            join(<1..270,371..>643)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>643)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IZ9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IZ9"
FT                   /protein_id="AAK38422.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRVYLEGLC
FT                   VESLRRYLENGKETLQR"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..643
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501"
FT                   /number=3
XX
SQ   Sequence 643 BP; 114 A; 168 C; 187 G; 74 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gtctacctgg agggcctgtg cgtggagtcg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcg                         643
//


spacer
spacer