spacer

EBI Dbfetch

ID   AH010664; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH010664; AY016211-AY016212;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*0801 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Baldassarre L.A., Hurley C.K.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Baldassarre L.A., Hurley C.K.;
RT   ;
RL   Submitted (12-DEC-2000) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 7f84130bf93964de13b5881cdd9ea90d.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13793978, gi:13793979, gi:13793977.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00386"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30460"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AGB"
FT                   /db_xref="PDB:1AGC"
FT                   /db_xref="PDB:1AGD"
FT                   /db_xref="PDB:1AGE"
FT                   /db_xref="PDB:1AGF"
FT                   /db_xref="PDB:1M05"
FT                   /db_xref="PDB:1MI5"
FT                   /db_xref="PDB:3FFC"
FT                   /db_xref="PDB:3SJV"
FT                   /db_xref="PDB:3SKM"
FT                   /db_xref="PDB:3SKO"
FT                   /db_xref="PDB:3SPV"
FT                   /db_xref="PDB:3X13"
FT                   /db_xref="PDB:3X14"
FT                   /db_xref="PDB:4QRP"
FT                   /db_xref="PDB:4QRQ"
FT                   /db_xref="PDB:4QRS"
FT                   /db_xref="PDB:4QRT"
FT                   /db_xref="PDB:4QRU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30460"
FT                   /protein_id="AAK38401.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..645
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 174 C; 192 G; 67 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer