spacer

EBI Dbfetch

ID   AY007565; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY007565;
XX
DT   05-SEP-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2001.580308.x.
RX   PUBMED; 11703828.
RA   Palou E., Campos E., Gil J., Santos M., Nogues N., Ribera A.;
RT   "Identification of a new HLA-DRB1*04 allele, DRB1*0437";
RL   Tissue Antigens 58(3):187-189(2001).
XX
RN   [2]
RP   1-270
RA   Palou E., Campos E., Gil J., Santos M., Nogues N., Ribera A.;
RT   ;
RL   Submitted (30-AUG-2000) to the INSDC.
RL   Immunohematologia, Centre de Transfusio i Banc de Teixits, Pg. Vall
RL   d'Hebron 119-129, Barcelona 08035, Spain
XX
DR   MD5; 37baee9e9dcc395b9b8f78dac2b69f25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95HL4"
FT                   /db_xref="IMGT/HLA:DRB1*04:37"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HL4"
FT                   /protein_id="AAG12983.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 65 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer