spacer

EBI Dbfetch

ID   AM993049; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM993049;
XX
DT   14-MAY-2008 (Rel. 95, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*37new
DE   allele, exon 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Emmerich F.;
RT   ;
RL   Submitted (06-MAY-2008) to the INSDC.
RL   Emmerich F., Transfusion Medicine, Charite University Hospital,
RL   Augustenburger Platz 1, 13353 Berlin Germany, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01160.x.
RX   PUBMED; 19000135.
RA   Emmerich F., Schoenemann C., Diederich G., Salama A.;
RT   "Haplotype-specific sequencing reveals a novel HLA-B*37 allele, B*3714";
RL   Tissue Antigens 73(1):67-67(2009).
XX
DR   MD5; 4a6e061d806a8aca4f88611b06cd5ae8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B2RG98"
FT                   /db_xref="IMGT/HLA:B*37:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2RG98"
FT                   /protein_id="CAQ52683.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLLRYYNQSEAGSHTIQRMSGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..546
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 174 C; 188 G; 73 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac catccagagg atgtctggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer