spacer

EBI Dbfetch

ID   AM992173; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   AM992173;
XX
DT   10-MAY-2008 (Rel. 95, Created)
DT   10-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*10new
DE   allele, exon 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Enczmann J.;
RT   ;
RL   Submitted (30-APR-2008) to the INSDC.
RL   Enczmann J., ITZ, University Clinic Duesseldorf, 40225 Duesseldorf, NRW,
RL   GERMANY.
XX
RN   [2]
RA   Ogrzewalla K., Tillmann G., Scheibelhut N., Lauber J., Enczmann J.;
RT   "A novel HLA-DRB1*10 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; 1fe905342f2ba890d1102cb5787e6d01.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*10new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B2RG90"
FT                   /db_xref="IMGT/HLA:DRB1*10:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B2RG90"
FT                   /protein_id="CAQ51484.1"
FT                   /translation="RFLEEVKFECHFFNGTERVRLLERRVHNQEEYARFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPQSG
FT                   EVYTCQVEHPSVMSPLTVEW"
FT   exon            <1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*10new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>652
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*10new"
FT                   /number=3
XX
SQ   Sequence 652 BP; 125 A; 135 C; 184 G; 108 T; 100 other;
     cacgtttctt ggaggaggtt aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttgctgga aagacgcgtc cataaccaag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgtgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ttcaacctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca cgggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcagagtgg agaggtttac       600
     acctgccaag tggagcaccc aagtgtgatg agccctctca cagtggaatg ga               652
//


spacer
spacer