Dbfetch

ID   AM980455; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM980455;
XX
DT   04-APR-2008 (Rel. 95, Created)
DT   04-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-C*14 allele,
DE   isolate 319348, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (02-APR-2008) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Ohashi M.K., Mastromarino S.A., Alosco S.M., Zannelli G.,
RA   Yu N.;
RT   "Novel HLA Class I alleles identified in minority populations";
RL   Unpublished.
XX
DR   MD5; b0286cb80cbe7c3db754e720c5a11aed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="319348"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="IMGT/HLA:C*14:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B1VK54"
FT                   /protein_id="CAQ35185.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=3
XX
SQ   Sequence 646 BP; 103 A; 171 C; 200 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtttggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcga                      646
//