Dbfetch

ID   AM950323; SV 1; linear; genomic DNA; STD; HUM; 1694 BP.
XX
AC   AM950323;
XX
DT   14-APR-2008 (Rel. 95, Created)
DT   14-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*68new
DE   allele, exons 1-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1694
RA   Dormoy A.;
RT   ;
RL   Submitted (01-APR-2008) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Leisenbach R., Bert S.;
RT   "The HLA-A*68 new allele has 1 nucleotide change from the A*680101 allele
RT   at position 87 of exon 2 where G->A (codon 5 (ATG -> ATA)) resulting in a
RT   change of amino acid : Met -> Ileu";
RL   Unpublished.
XX
DR   MD5; 1a928e7afcb8b16fd5bad1422b5aba3e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1694
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala C-9, fwd_seq:
FT                   tgacccagacctgggca, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..26,157..426,668..943,1186..1461,1561..>1677)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT   CDS             join(<1..26,157..426,668..943,1186..1461,1561..>1677)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B2G3G4"
FT                   /db_xref="IMGT/HLA:A*68:43"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B2G3G4"
FT                   /protein_id="CAQ37790.1"
FT                   /translation="LALTQTWAGSHSIRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFD
FT                   SDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ
FT                   MMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQ
FT                   WRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLR
FT                   WEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSS"
FT   exon            <1..26
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=1
FT   intron          27..156
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=1
FT   exon            157..426
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=2
FT   intron          427..667
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=2
FT   exon            668..943
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=3
FT   intron          944..1185
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=3
FT   exon            1186..1461
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=4
FT   intron          1462..1560
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=4
FT   exon            1561..1677
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=5
FT   intron          1678..>1694
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=5
XX
SQ   Sequence 1694 BP; 321 A; 513 C; 583 G; 277 T; 0 other;
     cctggccctg acccagacct gggcgggtga gtgcggggtc gggagggaaa cggcctctgt        60
     ggggagaagc aaggggcccg cccggcgggg gcgcaggacc cgggaagccg cgcctggagg       120
     agggtcgggc gggtctcagc cactcctcgc ccccaggctc ccactccata aggtatttct       180
     acacctccgt gtcccggccc ggccgcgggg agccccgctt catcgccgtg ggctacgtgg       240
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaggatg gagccgcggg       300
     cgccgtggat agagcaggag gggccggagt attgggaccg gaacacacgg aatgtgaagg       360
     cccagtcaca gactgaccga gtggacctgg ggaccctgcg cggctactac aaccagagcg       420
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac ccctcatccc ccacggacgg       480
     gccaggtcgc ccacagtctc cgggtccgag atccgccccg aagccgcggg accccgagac       540
     ccttgccccg ggagaggccc aggcgccttt acccggtttc attttcagtt taggccaaaa       600
     atccccccgg gttggtcggg gcggggcggg gctcggggga ccgggctgac ctcggggtcc       660
     gggccaggtt ctcacaccat ccagatgatg tatggctgcg acgtggggtc ggacgggcgc       720
     ttcctccgcg ggtaccggca ggacgcctac gacggcaagg attacatcgc cctgaaagag       780
     gacctgcgct cttggaccgc ggcggacatg gcagctcaga ccaccaagca caagtgggag       840
     gcggcccatg tggcggagca gtggagagcc tacctggagg gcacgtgcgt ggagtggctc       900
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgca cgggtaccag gggccacggg       960
     gcgcctccct gatcgcctgt agatctcccg ggctggcctc ccacaaggag gggagacaat      1020
     tgggaccaac actagaatat cgccctccct ctggtcctga gggagaggaa tcctcctggg      1080
     tttccagatc ctgtaccaga gagtgactct gaggttccgc cctgctctct gacacaatta      1140
     agggataaaa tctctgaagg aatgagatct gactcttcct gacagacgcc cccaaaacgc      1200
     atatgactca ccacgctgtc tctgaccatg aagccaccct gaggtgctgg gccctgagct      1260
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag acccaggaca      1320
     cggagctcgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg gtggctgtgg      1380
     tggtgccttc tggacaggag cagagataca cctgccatgt gcagcatgag ggtttgccca      1440
     agcccctcac cctgagatgg ggtaaggagg gagacggggg tgtcatgtct tttagggaaa      1500
     gcaggagcct ctctgacctt tagcagggtc agggcccctc accttcccct cttttcccag      1560
     agccgtcttc ccagcccacc atccccatcg tgggcatcat tgctggcctg gttctctttg      1620
     gagctgtgat cactggagct gtggtcgctg ctgtgatgtg gaggaggaag agctcaggtg      1680
     gggaaggggt gaag                                                        1694
//