spacer

EBI Dbfetch

ID   AM947655; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM947655;
XX
DT   20-APR-2008 (Rel. 95, Created)
DT   20-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*04var
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04var allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (20-MAR-2008) to the INSDC.
RL   Tiercy J.M., University Hospital Geneva, Transplantation Immunology
RL   Unit/LNRH, 24 rue Micheli-du-Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Desaules C., Tiercy J.M.;
RT   "Exon 2 sequence of a new HLA-DRB1*04 allele with an unusual residue at
RT   position 77";
RL   Unpublished.
XX
DR   MD5; 21a61c0fcdc26d9cf28f8df988724bb6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B2G3E5"
FT                   /db_xref="IMGT/HLA:DRB1*04:74"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B2G3E5"
FT                   /protein_id="CAQ19355.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04var"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 62 C; 98 G; 49 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer