spacer

EBI Dbfetch

ID   AM947068; SV 1; linear; genomic DNA; STD; HUM; 309 BP.
XX
AC   AM947068;
XX
DT   26-MAR-2008 (Rel. 95, Created)
DT   26-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*09
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-309
RA   Liu X.;
RT   ;
RL   Submitted (19-MAR-2008) to the INSDC.
RL   Liu X., HLA typing lab, CapitalBio Corporation, 18 Life Science Parkway
RL   Changping District, Beijing 102206, CHINA.
XX
RN   [2]
RA   Liu X., Liu Y., Li L., Lan G.;
RT   "Identification of a novel HLA-DRB1 allele in a Chinese population";
RL   Unpublished.
XX
DR   MD5; bfbda101eb9f66133ebca7377d79ec11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..309
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B1VJP6"
FT                   /db_xref="IMGT/HLA:DRB1*09:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B1VJP6"
FT                   /protein_id="CAQ30221.1"
FT                   /translation="RFLQQDKYECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09"
FT                   /number=2
XX
SQ   Sequence 309 BP; 65 A; 70 C; 121 G; 53 T; 0 other;
     cacgtttctt gcagcaggat aagtatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag gtaagcatgg tggggggcgg ggcctgggtc       300
     cctgtgaac                                                               309
//


spacer
spacer