spacer

EBI Dbfetch

ID   AM946015; SV 1; circular; genomic DNA; STD; PRO; 1852352 BP.
XX
AC   AM946015;
XX
PR   Project:PRJNA353;
XX
DT   28-JAN-2009 (Rel. 99, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Streptococcus uberis 0140J complete genome
XX
KW   complete genome.
XX
OS   Streptococcus uberis 0140J
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-1852352
RA   Holden M.T.G.;
RT   ;
RL   Submitted (10-MAR-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Genomics, Sanger Institute Wellcome Trust, Wellcome
RL   Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RA   Ward P.N., Holden M.T.G., Leigh J.A., Lennard N., Bignell A., Barron A.,
RA   Clark L., Quail M.A., Woodward J., Barrell B.G., Egan S.A., Field T.R.,
RA   Maskell D., Kehoe M., Dowson C.G., Chanter N., Whatmore A.M., Bentley S.D.,
RA   Parkhill J.;
RT   "Evidence for niche adaptation in the genome of the bovine pathogen
RT   Streptococcus uberis";
RL   BMC Genet. 10(54):0-0(2009).
XX
DR   MD5; c211425afff8c50f850f6b557fbca809.
DR   EnsemblGenomes-Gn; EBG00000028068.
DR   EnsemblGenomes-Gn; EBG00000028070.
DR   EnsemblGenomes-Gn; EBG00000028072.
DR   EnsemblGenomes-Gn; EBG00000028074.
DR   EnsemblGenomes-Gn; EBG00000028076.
DR   EnsemblGenomes-Gn; EBG00000028078.
DR   EnsemblGenomes-Gn; EBG00000028080.
DR   EnsemblGenomes-Gn; EBG00000028084.
DR   EnsemblGenomes-Gn; EBG00000028086.
DR   EnsemblGenomes-Gn; EBG00000028087.
DR   EnsemblGenomes-Gn; EBG00000028089.
DR   EnsemblGenomes-Gn; EBG00000028091.
DR   EnsemblGenomes-Gn; EBG00000028092.
DR   EnsemblGenomes-Gn; EBG00000028094.
DR   EnsemblGenomes-Gn; EBG00000028096.
DR   EnsemblGenomes-Gn; EBG00000028097.
DR   EnsemblGenomes-Gn; EBG00000028099.
DR   EnsemblGenomes-Gn; EBG00000028101.
DR   EnsemblGenomes-Gn; EBG00000028104.
DR   EnsemblGenomes-Gn; EBG00000028105.
DR   EnsemblGenomes-Gn; EBG00000028106.
DR   EnsemblGenomes-Gn; EBG00000028108.
DR   EnsemblGenomes-Gn; EBG00000028111.
DR   EnsemblGenomes-Gn; EBG00000028113.
DR   EnsemblGenomes-Gn; EBG00000028114.
DR   EnsemblGenomes-Gn; EBG00000028116.
DR   EnsemblGenomes-Gn; EBG00000028118.
DR   EnsemblGenomes-Gn; EBG00000028120.
DR   EnsemblGenomes-Gn; EBG00000028121.
DR   EnsemblGenomes-Gn; EBG00000028123.
DR   EnsemblGenomes-Gn; EBG00000028125.
DR   EnsemblGenomes-Gn; EBG00000028127.
DR   EnsemblGenomes-Gn; EBG00000028129.
DR   EnsemblGenomes-Gn; EBG00000028130.
DR   EnsemblGenomes-Gn; EBG00000028132.
DR   EnsemblGenomes-Gn; EBG00000028134.
DR   EnsemblGenomes-Gn; EBG00000028136.
DR   EnsemblGenomes-Gn; EBG00000028140.
DR   EnsemblGenomes-Gn; EBG00000028142.
DR   EnsemblGenomes-Gn; EBG00000028143.
DR   EnsemblGenomes-Gn; EBG00000028145.
DR   EnsemblGenomes-Gn; EBG00000028147.
DR   EnsemblGenomes-Gn; EBG00000028149.
DR   EnsemblGenomes-Gn; EBG00000028152.
DR   EnsemblGenomes-Gn; EBG00000028154.
DR   EnsemblGenomes-Gn; EBG00000028155.
DR   EnsemblGenomes-Gn; EBG00000028158.
DR   EnsemblGenomes-Gn; EBG00000028160.
DR   EnsemblGenomes-Gn; EBG00000028162.
DR   EnsemblGenomes-Gn; EBG00000028164.
DR   EnsemblGenomes-Gn; EBG00000028166.
DR   EnsemblGenomes-Gn; EBG00000028168.
DR   EnsemblGenomes-Gn; EBG00000028170.
DR   EnsemblGenomes-Gn; EBG00000028174.
DR   EnsemblGenomes-Gn; EBG00000028176.
DR   EnsemblGenomes-Gn; EBG00000028178.
DR   EnsemblGenomes-Gn; EBG00000028180.
DR   EnsemblGenomes-Gn; EBG00000028182.
DR   EnsemblGenomes-Gn; EBG00000028183.
DR   EnsemblGenomes-Gn; EBG00000028186.
DR   EnsemblGenomes-Gn; EBG00000028188.
DR   EnsemblGenomes-Gn; EBG00000028190.
DR   EnsemblGenomes-Gn; EBG00000028192.
DR   EnsemblGenomes-Gn; EBG00000028194.
DR   EnsemblGenomes-Gn; EBG00000028197.
DR   EnsemblGenomes-Gn; EBG00000028199.
DR   EnsemblGenomes-Gn; EBG00000028201.
DR   EnsemblGenomes-Gn; EBG00000028203.
DR   EnsemblGenomes-Gn; EBG00000028205.
DR   EnsemblGenomes-Gn; EBG00000028206.
DR   EnsemblGenomes-Gn; EBG00000028208.
DR   EnsemblGenomes-Gn; EBG00000028210.
DR   EnsemblGenomes-Gn; EBG00000028212.
DR   EnsemblGenomes-Gn; EBG00000028214.
DR   EnsemblGenomes-Gn; SUB0031.
DR   EnsemblGenomes-Gn; SUB0037A.
DR   EnsemblGenomes-Gn; SUB0096.
DR   EnsemblGenomes-Gn; SUB0147.
DR   EnsemblGenomes-Gn; SUB0164.
DR   EnsemblGenomes-Gn; SUB0249.
DR   EnsemblGenomes-Gn; SUB0272.
DR   EnsemblGenomes-Gn; SUB0280.
DR   EnsemblGenomes-Gn; SUB0292A.
DR   EnsemblGenomes-Gn; SUB0293.
DR   EnsemblGenomes-Gn; SUB0327.
DR   EnsemblGenomes-Gn; SUB0327A.
DR   EnsemblGenomes-Gn; SUB0348.
DR   EnsemblGenomes-Gn; SUB0361.
DR   EnsemblGenomes-Gn; SUB0461.
DR   EnsemblGenomes-Gn; SUB0476.
DR   EnsemblGenomes-Gn; SUB0502.
DR   EnsemblGenomes-Gn; SUB0504.
DR   EnsemblGenomes-Gn; SUB0510A.
DR   EnsemblGenomes-Gn; SUB0511.
DR   EnsemblGenomes-Gn; SUB0589.
DR   EnsemblGenomes-Gn; SUB0611.
DR   EnsemblGenomes-Gn; SUB0612.
DR   EnsemblGenomes-Gn; SUB0653.
DR   EnsemblGenomes-Gn; SUB0764.
DR   EnsemblGenomes-Gn; SUB0790.
DR   EnsemblGenomes-Gn; SUB0790A.
DR   EnsemblGenomes-Gn; SUB0804.
DR   EnsemblGenomes-Gn; SUB0805.
DR   EnsemblGenomes-Gn; SUB0828.
DR   EnsemblGenomes-Gn; SUB0887.
DR   EnsemblGenomes-Gn; SUB1035.
DR   EnsemblGenomes-Gn; SUB1052.
DR   EnsemblGenomes-Gn; SUB1064.
DR   EnsemblGenomes-Gn; SUB1067.
DR   EnsemblGenomes-Gn; SUB1089.
DR   EnsemblGenomes-Gn; SUB1099.
DR   EnsemblGenomes-Gn; SUB1170A.
DR   EnsemblGenomes-Gn; SUB1171.
DR   EnsemblGenomes-Gn; SUB1178.
DR   EnsemblGenomes-Gn; SUB1178A.
DR   EnsemblGenomes-Gn; SUB1186.
DR   EnsemblGenomes-Gn; SUB1208.
DR   EnsemblGenomes-Gn; SUB1259.
DR   EnsemblGenomes-Gn; SUB1340.
DR   EnsemblGenomes-Gn; SUB1346.
DR   EnsemblGenomes-Gn; SUB1438A.
DR   EnsemblGenomes-Gn; SUB1440.
DR   EnsemblGenomes-Gn; SUB1450.
DR   EnsemblGenomes-Gn; SUB1483.
DR   EnsemblGenomes-Gn; SUB1522.
DR   EnsemblGenomes-Gn; SUB1587.
DR   EnsemblGenomes-Gn; SUB1594.
DR   EnsemblGenomes-Gn; SUB1599.
DR   EnsemblGenomes-Gn; SUB1600.
DR   EnsemblGenomes-Gn; SUB1608.
DR   EnsemblGenomes-Gn; SUB1609.
DR   EnsemblGenomes-Gn; SUB1672.
DR   EnsemblGenomes-Gn; SUB1677.
DR   EnsemblGenomes-Gn; SUB1739.
DR   EnsemblGenomes-Gn; SUB1798.
DR   EnsemblGenomes-Gn; SUB1807.
DR   EnsemblGenomes-Gn; SUB1817.
DR   EnsemblGenomes-Tr; EBG00000028068.
DR   EnsemblGenomes-Tr; EBG00000028070.
DR   EnsemblGenomes-Tr; EBG00000028072.
DR   EnsemblGenomes-Tr; EBG00000028074.
DR   EnsemblGenomes-Tr; EBG00000028076.
DR   EnsemblGenomes-Tr; EBG00000028078.
DR   EnsemblGenomes-Tr; EBG00000028080.
DR   EnsemblGenomes-Tr; EBG00000028084.
DR   EnsemblGenomes-Tr; EBG00000028086.
DR   EnsemblGenomes-Tr; EBG00000028087.
DR   EnsemblGenomes-Tr; EBG00000028089.
DR   EnsemblGenomes-Tr; EBG00000028091.
DR   EnsemblGenomes-Tr; EBG00000028092.
DR   EnsemblGenomes-Tr; EBG00000028094.
DR   EnsemblGenomes-Tr; EBG00000028096.
DR   EnsemblGenomes-Tr; EBG00000028097.
DR   EnsemblGenomes-Tr; EBG00000028099.
DR   EnsemblGenomes-Tr; EBG00000028101.
DR   EnsemblGenomes-Tr; EBG00000028104.
DR   EnsemblGenomes-Tr; EBG00000028105.
DR   EnsemblGenomes-Tr; EBG00000028106.
DR   EnsemblGenomes-Tr; EBG00000028108.
DR   EnsemblGenomes-Tr; EBG00000028111.
DR   EnsemblGenomes-Tr; EBG00000028113.
DR   EnsemblGenomes-Tr; EBG00000028114.
DR   EnsemblGenomes-Tr; EBG00000028116.
DR   EnsemblGenomes-Tr; EBG00000028118.
DR   EnsemblGenomes-Tr; EBG00000028120.
DR   EnsemblGenomes-Tr; EBG00000028121.
DR   EnsemblGenomes-Tr; EBG00000028123.
DR   EnsemblGenomes-Tr; EBG00000028125.
DR   EnsemblGenomes-Tr; EBG00000028127.
DR   EnsemblGenomes-Tr; EBG00000028129.
DR   EnsemblGenomes-Tr; EBG00000028130.
DR   EnsemblGenomes-Tr; EBG00000028132.
DR   EnsemblGenomes-Tr; EBG00000028134.
DR   EnsemblGenomes-Tr; EBG00000028136.
DR   EnsemblGenomes-Tr; EBG00000028140.
DR   EnsemblGenomes-Tr; EBG00000028142.
DR   EnsemblGenomes-Tr; EBG00000028143.
DR   EnsemblGenomes-Tr; EBG00000028145.
DR   EnsemblGenomes-Tr; EBG00000028147.
DR   EnsemblGenomes-Tr; EBG00000028149.
DR   EnsemblGenomes-Tr; EBG00000028152.
DR   EnsemblGenomes-Tr; EBG00000028154.
DR   EnsemblGenomes-Tr; EBG00000028155.
DR   EnsemblGenomes-Tr; EBG00000028158.
DR   EnsemblGenomes-Tr; EBG00000028160.
DR   EnsemblGenomes-Tr; EBG00000028162.
DR   EnsemblGenomes-Tr; EBG00000028164.
DR   EnsemblGenomes-Tr; EBG00000028166.
DR   EnsemblGenomes-Tr; EBG00000028168.
DR   EnsemblGenomes-Tr; EBG00000028170.
DR   EnsemblGenomes-Tr; EBG00000028174.
DR   EnsemblGenomes-Tr; EBG00000028176.
DR   EnsemblGenomes-Tr; EBG00000028178.
DR   EnsemblGenomes-Tr; EBG00000028180.
DR   EnsemblGenomes-Tr; EBG00000028182.
DR   EnsemblGenomes-Tr; EBG00000028183.
DR   EnsemblGenomes-Tr; EBG00000028186.
DR   EnsemblGenomes-Tr; EBG00000028188.
DR   EnsemblGenomes-Tr; EBG00000028190.
DR   EnsemblGenomes-Tr; EBG00000028192.
DR   EnsemblGenomes-Tr; EBG00000028194.
DR   EnsemblGenomes-Tr; EBG00000028197.
DR   EnsemblGenomes-Tr; EBG00000028199.
DR   EnsemblGenomes-Tr; EBG00000028201.
DR   EnsemblGenomes-Tr; EBG00000028203.
DR   EnsemblGenomes-Tr; EBG00000028205.
DR   EnsemblGenomes-Tr; EBG00000028206.
DR   EnsemblGenomes-Tr; EBG00000028208.
DR   EnsemblGenomes-Tr; EBG00000028210.
DR   EnsemblGenomes-Tr; EBG00000028212.
DR   EnsemblGenomes-Tr; EBG00000028214.
DR   EnsemblGenomes-Tr; SUB0031.
DR   EnsemblGenomes-Tr; SUB0037A.
DR   EnsemblGenomes-Tr; SUB0096.
DR   EnsemblGenomes-Tr; SUB0147.
DR   EnsemblGenomes-Tr; SUB0164.
DR   EnsemblGenomes-Tr; SUB0249.
DR   EnsemblGenomes-Tr; SUB0272.
DR   EnsemblGenomes-Tr; SUB0280.
DR   EnsemblGenomes-Tr; SUB0292A.
DR   EnsemblGenomes-Tr; SUB0293.
DR   EnsemblGenomes-Tr; SUB0327.
DR   EnsemblGenomes-Tr; SUB0327A.
DR   EnsemblGenomes-Tr; SUB0348.
DR   EnsemblGenomes-Tr; SUB0361.
DR   EnsemblGenomes-Tr; SUB0461.
DR   EnsemblGenomes-Tr; SUB0476.
DR   EnsemblGenomes-Tr; SUB0502.
DR   EnsemblGenomes-Tr; SUB0504.
DR   EnsemblGenomes-Tr; SUB0510A.
DR   EnsemblGenomes-Tr; SUB0511.
DR   EnsemblGenomes-Tr; SUB0589.
DR   EnsemblGenomes-Tr; SUB0611.
DR   EnsemblGenomes-Tr; SUB0612.
DR   EnsemblGenomes-Tr; SUB0653.
DR   EnsemblGenomes-Tr; SUB0764.
DR   EnsemblGenomes-Tr; SUB0790.
DR   EnsemblGenomes-Tr; SUB0790A.
DR   EnsemblGenomes-Tr; SUB0804.
DR   EnsemblGenomes-Tr; SUB0805.
DR   EnsemblGenomes-Tr; SUB0828.
DR   EnsemblGenomes-Tr; SUB0887.
DR   EnsemblGenomes-Tr; SUB1035.
DR   EnsemblGenomes-Tr; SUB1052.
DR   EnsemblGenomes-Tr; SUB1064.
DR   EnsemblGenomes-Tr; SUB1067.
DR   EnsemblGenomes-Tr; SUB1089.
DR   EnsemblGenomes-Tr; SUB1099.
DR   EnsemblGenomes-Tr; SUB1170A.
DR   EnsemblGenomes-Tr; SUB1171.
DR   EnsemblGenomes-Tr; SUB1178.
DR   EnsemblGenomes-Tr; SUB1178A.
DR   EnsemblGenomes-Tr; SUB1186.
DR   EnsemblGenomes-Tr; SUB1208.
DR   EnsemblGenomes-Tr; SUB1259.
DR   EnsemblGenomes-Tr; SUB1340.
DR   EnsemblGenomes-Tr; SUB1346.
DR   EnsemblGenomes-Tr; SUB1438A.
DR   EnsemblGenomes-Tr; SUB1440.
DR   EnsemblGenomes-Tr; SUB1450.
DR   EnsemblGenomes-Tr; SUB1483.
DR   EnsemblGenomes-Tr; SUB1522.
DR   EnsemblGenomes-Tr; SUB1587.
DR   EnsemblGenomes-Tr; SUB1594.
DR   EnsemblGenomes-Tr; SUB1599.
DR   EnsemblGenomes-Tr; SUB1600.
DR   EnsemblGenomes-Tr; SUB1608.
DR   EnsemblGenomes-Tr; SUB1609.
DR   EnsemblGenomes-Tr; SUB1672.
DR   EnsemblGenomes-Tr; SUB1677.
DR   EnsemblGenomes-Tr; SUB1739.
DR   EnsemblGenomes-Tr; SUB1798.
DR   EnsemblGenomes-Tr; SUB1807.
DR   EnsemblGenomes-Tr; SUB1817.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC3091779; 21106082.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3298175; 22247135.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AM946015.
DR   SILVA-SSU; AM946015.
DR   StrainInfo; 493299; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1852352
FT                   /organism="Streptococcus uberis 0140J"
FT                   /strain="0140J"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:218495"
FT   CDS             1..1356
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SUB0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40315"
FT                   /db_xref="GOA:B9DSN7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSN7"
FT                   /protein_id="CAR40315.1"
FT                   /translation="MTENETIFWNRILELAQSQLKQTTYEFFVLDARLVKVENQVATIY
FT                   LDPMKELFWEQNLKDVILTAGFEVFNAHISVNYQFEDDLASEIEESTSNHIFSRQTINS
FT                   LPAITSDLNPKYSFDNFIQGDENRWAVAASLAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNAVLLDNPKARVKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLLGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEQRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFTFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKEIDKITVD
FT                   IAAEAIRARKQDTPKMTIIPIEEIQTQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMIIEDESLRIEIETIKNKIK"
FT   misc_feature    334..1287
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SUB0001"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
FT                   score 1.6e-157"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    454..477
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    1228..1287
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS             1510..2646
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SUB0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40317"
FT                   /db_xref="GOA:B9DSN8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSN8"
FT                   /protein_id="CAR40317.1"
FT                   /translation="MIQFSINRSLFIQALNATKRAISSKNAIPVLSTIKIEVSSTDITL
FT                   TGSNGQISIENTIPVSNENAGLLITDTGSILLEANFFINIISSLPDVTLDFKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTDNPLVLETKLLKSLINETAFAASTQESRPILT
FT                   GVHLTLSNHKDFKAVATDSHRMSQRLLVLDKASTDFNVVIPSRSLREFSSVFTDDIETV
FT                   EIFFSPSQILFRSENISFYTRLLEGNYPDTDRLLINQFETEATFNTQALRHAMERAFLI
FT                   SNATQNGTVKLEIKENTISAHVNSPEVGKVNEELEIVEKSGSDLTISFNPTYLIEALKA
FT                   LKSETVRIRFVSPVRPFTLTPGDDEEGFIQLITPVRTN"
FT   misc_feature    1513..1890
FT                   /gene="dnaN"
FT                   /locus_tag="SUB0002"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 6.9e-25"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    1915..2262
FT                   /gene="dnaN"
FT                   /locus_tag="SUB0002"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 1.8e-36"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2266..2637
FT                   /gene="dnaN"
FT                   /locus_tag="SUB0002"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 8.2e-30"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS             2720..2929
FT                   /transl_table=11
FT                   /locus_tag="SUB0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40319"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSN9"
FT                   /protein_id="CAR40319.1"
FT                   /translation="MYHLGTIVEMKKPHACVIKETGKKANSWKIVRLGADIKIQCQNCD
FT                   HIVMMSRHDFERKMKKIIGQPENL"
FT   misc_feature    2720..2911
FT                   /locus_tag="SUB0003"
FT                   /note="HMMPfam hit to PF06107, Bacterial protein of unknown
FT                   function (DUF95, score 2.8e-43"
FT                   /inference="protein motif:HMMPfam:PF06107"
FT   CDS             3036..3443
FT                   /transl_table=11
FT                   /locus_tag="SUB0004"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40321"
FT                   /db_xref="GOA:B9DSP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP0"
FT                   /protein_id="CAR40321.1"
FT                   /translation="MTPFSSQLKILRQAKNLSQEALAEQLFISRQAISKWENGDATPDL
FT                   ENLVKLAEIFKVSLDELVLGKKIDSNQDDEEDDENLHLLTNREYVLNPETGRYEKRDGL
FT                   TILIDIISEYWWIIFFAPILIMFIKLLINLF"
FT   misc_feature    3057..3221
FT                   /locus_tag="SUB0004"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5.1e-20"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    3084..3149
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2374.000, SD 7.27 at aa 17-38, sequence
FT                   LSQEALAEQLFISRQAISKWEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    3375..3434
FT                   /note="1 probable transmembrane helix predicted for SUB0004
FT                   by TMHMM2.0 at aa 114-133"
FT   CDS             3524..4639
FT                   /transl_table=11
FT                   /locus_tag="SUB0005"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40322"
FT                   /db_xref="GOA:B9DSP1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP1"
FT                   /protein_id="CAR40322.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNIGMVE
FT                   VPDERLDKLTELIIPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGRDDAFVDPMADIDTINLELILADLDSINKRYARVEKMARTQKDKDS
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEDEAKIVKGLFLLTTKPVLYVANVDEDRVANPD
FT                   DINYVKQIREFAQTENAEVVVISARAEEEISELDDEDKGEFLEAIGLKESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLIKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   misc_feature    3530..3880
FT                   /locus_tag="SUB0005"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1.4e-34"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    3548..3571
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    4382..4633
FT                   /locus_tag="SUB0005"
FT                   /note="HMMPfam hit to PF06071, Protein of unknown function
FT                   (DUF933), score 2.7e-61"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   CDS             4712..5281
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SUB0006"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40326"
FT                   /db_xref="GOA:B9DSP2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSP2"
FT                   /protein_id="CAR40326.1"
FT                   /translation="MVKMIVGLGNPGSKYDNTKHNIGFMAIDTIVKNLDINFTEEKNFK
FT                   ALVGSTFINQEKIYFVKPVTFMNNSGIAVKALLTYYNISIQDLIVIYDDLDMEVGKIRF
FT                   RQKGSAGGHNGIKSIISHIGTQEFDRIKIGIGRPKQGMTVINHVLGKFDQDDDITIKNT
FT                   LNKVDNAVNYYLQMKNFEKTMQKYNG"
FT   misc_feature    4721..5275
FT                   /gene="pth"
FT                   /locus_tag="SUB0006"
FT                   /note="HMMPfam hit to PF01195, Peptidyl-tRNA hydrolase,
FT                   score 1.1e-76"
FT                   /inference="protein motif:HMMPfam:PF01195"
FT   misc_feature    5036..5068
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2."
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS             5285..8785
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /product="putative transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40328"
FT                   /db_xref="GOA:B9DSP3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP3"
FT                   /protein_id="CAR40328.1"
FT                   /translation="MDILELFSQSQIAQSWYSGSMTLGRQLLMGLSGSSKALAIAANFE
FT                   SQDEKLVVVTSSQNESEKLASDLSAILGEEYIYQFFSDDVAAAEFIFSSLDKTISRVEA
FT                   IKFLLDDTEKGILITSIVGLRVLLPSPKTFLTSYLSLSIGNEYNLDTIVKQLTTMGYHK
FT                   VSQVLHPGEYSKRGDILDVYEITKENPYRIEFFGDEVDGIREFNLDTQLSLSTVNEIEI
FT                   SPASDLILEKNDFIRGINNLEKAYKVANDDLKKYLSEIISVSKNDYCHKDIRKFISLFY
FT                   QDKWTLMDYITKGVPIFFDDFQKILDKNAKFDLEIANLLTDDLQSSKAIPSLSYFDDNY
FT                   KKIRNYKPATFFSNFHKGLGNIKFDKIHQFTQYSMQEFFSQFPLLIDEISRYQKSKSTV
FT                   IIQVESQHAYDRLMKNFSEYHFSAPLVSSNELQRQKIQIVIGSLSSGFYLADEKIAYIT
FT                   EREIYHKKIKRKVRKSNISNAERLKDYNELVKGDYVVHNVHGIGKFLGIETIQIHGIHR
FT                   DYVTIQYQNSDTISLPVEQIESLSKYVSADGKEPKINKLNDGRFQKTKQKVAKQVEDIA
FT                   DDLLKLYAERSQQKGFSFSADDDLQKSFDDDFPYVETEDQIRSIIEIKQDMESNHPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAILVPTTVLAQQHFENFKERFENYPIEIDVL
FT                   SRFRSKKEQGDTLEKLKKGQVDIIIGTHRLLSKDVQFSDLGLIVIDEEQRFGVKHKEKL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLETNPGLVREA
FT                   IIREMDRGGQCFYVYNKVDSIDKKVSELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFVENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEDAIAKRQGKTFVRQKGNSEINLQIDAYLPQNYMSDERQKIEIYKRIREIDDREDYLQ
FT                   LQDEIIDRFGEYPDQVAYLLEIGLLKSYMDQAFVELVERKDKIITIKFEKASLKYYFTQ
FT                   DYFEALSKTNLKAKIAENNGKIDIIFDIRNKKDHEILEELMLFGEMLSDIKKRKNIESN
FT                   "
FT   misc_feature    6743..7036
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /note="HMMPfam hit to PF02559, CarD-like/TRCF domain, score
FT                   1.4e-49"
FT                   /inference="protein motif:HMMPfam:PF02559"
FT   misc_feature    7112..7600
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 3.9e-07"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    7118..7615
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 1.4e-38"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    7199..7222
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    7805..8038
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    8318..8644
FT                   /gene="trcF"
FT                   /locus_tag="SUB0007"
FT                   /note="HMMPfam hit to PF03461, TRCF domain, score 1.8e-39"
FT                   /inference="protein motif:HMMPfam:PF03461"
FT   CDS             8772..10259
FT                   /transl_table=11
FT                   /locus_tag="SUB0008"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40330"
FT                   /db_xref="GOA:B9DSP4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP4"
FT                   /protein_id="CAR40330.1"
FT                   /translation="MNLISKSSLFITISGLISKILAAIYRIPYQNLVGDRGFYAYQQIY
FT                   PLLAIISALSLTALPNVVASLCQKNKKEDIQALFVFQIIMTTLLSLSLVIFNKEIAVFL
FT                   GSRQFAPSIIITAVVLLTVPFISIARGFAQAELDMTPTAVSQVIEQFIRIVIIILAAVC
FT                   YLIFDWTVYTTANVAACGNLIASLSVLFYFSKKNLKIDLIKSLIKNVNITYLTDIGLSS
FT                   FVFIFFSVYLLLFQFIDALFVKKTLVESGKIEIVAEITKGIYDRGQPLIQFGLIFSTAF
FT                   FTTFLPKLTKDYYIEKENYMTESQSFFEFIYYFNTTLSLGFMCILGSMNRFLFEDNNGW
FT                   LALEIYLGTIALSSFIQFFHQKMFIEENQKKSFIYLSFGLLLKIMLTPILTYYFSVIGS
FT                   SLSTVLPLVMILILYIRETTISLTVCKNRKFIFSLIVMSLTVLVSQYYLPSRTRLDNLI
FT                   SILVSTFSGLVVFLTISKRLKVFEDKLWSYLPFINEK"
FT   misc_feature    8781..9650
FT                   /locus_tag="SUB0008"
FT                   /note="HMMPfam hit to PF01943, Polysaccharide biosynthesis
FT                   protein, score 1.2e-05"
FT                   /inference="protein motif:HMMPfam:PF01943"
FT   misc_feature    order(8790..8858,8901..8969,9003..9062,9090..9158,
FT                   9219..9272,9282..9350,9408..9476,9576..9629,9690..9758,
FT                   9786..9848,9885..9944,9954..10022,10059..10112,
FT                   10140..10193)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SUB0008 by TMHMM2.0 at aa 13-35, 50-72, 84-103, 113-135,
FT                   156-173, 177-199, 219-241, 275-292, 313-335, 345-365,
FT                   378-397, 401-423, 436-453 and 463-480"
FT   CDS             10288..10560
FT                   /transl_table=11
FT                   /locus_tag="SUB0009"
FT                   /product="S4 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40331"
FT                   /db_xref="GOA:B9DSP5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP5"
FT                   /protein_id="CAR40331.1"
FT                   /translation="MRLDKFLKVSRIIKRRPVAKEVADKGRIKVNGVLAKSSTDLKIND
FT                   EIEIRFGNKLLTVKVLEMKDSTKKEDAVKMYEIIKELRVESHEEA"
FT   misc_feature    10288..10428
FT                   /locus_tag="SUB0009"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 2.2e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS             10547..10918
FT                   /transl_table=11
FT                   /locus_tag="SUB0010"
FT                   /product="putative septum formation initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40332"
FT                   /db_xref="GOA:B9DSP6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP6"
FT                   /protein_id="CAR40332.1"
FT                   /translation="MKKPSIVQLNNQYIAKENLKKRFEEEENQKRNRFMGWILVVMMFL
FT                   FILPTYNLVKSYVGLEKQNKQVIELKKEYQALDESTKVEKKLAKQLKDDDFVKKYARAK
FT                   YYLSQEGEVIYPIPGLLPK"
FT   misc_feature    10649..10906
FT                   /locus_tag="SUB0010"
FT                   /note="HMMPfam hit to PF04977, Septum formation initiator,
FT                   score 1.5e-06"
FT                   /inference="protein motif:HMMPfam:PF04977"
FT   misc_feature    10655..10708
FT                   /note="1 probable transmembrane helix predicted for SUB0010
FT                   by TMHMM2.0 at aa 37-54"
FT   CDS             10920..11048
FT                   /transl_table=11
FT                   /locus_tag="SUB0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40334"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP7"
FT                   /protein_id="CAR40334.1"
FT                   /translation="MENIVKKIETFLSYSDEKLEELHIENQKLKEESQSIAKKRKE"
FT   CDS             11051..12337
FT                   /transl_table=11
FT                   /locus_tag="SUB0012"
FT                   /product="putative exported protein"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40336"
FT                   /db_xref="GOA:B9DSP8"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP8"
FT                   /protein_id="CAR40336.1"
FT                   /translation="MKKLLACMLMVFFLSPISVISTEKSISFPSTTIHQLSQNVLTSST
FT                   YFNAIPKNPNVYDELQTYSDQSLTIPSGVLKPNDDFIINNLLLNQNNLPIFQLANGQFI
FT                   LANKKFIYEDETTNQTNLNSWLWLQKDFTIYEEPLVKGVLPINSDLKPYSKVHVTKLSQ
FT                   TQHGNFYYIENKGWVSEKYLSKADNRMVKVQEMLSQKYNKENYSIFVKQLTTQTSAGIN
FT                   ADKLMYSASIAKLATLYYVQNKIETGKTSLNQTLKYTDQVNHFKGDYDPSGSGKLPKTS
FT                   DNENYTVDDLLKAVAQHSDNVATNILGYYLANQYDRDFSTQMTAISGINWDMEERMLSS
FT                   KAAANVMESIYYQNGPIVSYLTNTDFDNQRISKNIAVPVAHKIGDAYDYKHDVAIVYSD
FT                   SPFILSIFSENASYDDITAIADGIYSILK"
FT   sig_peptide     11051..11131
FT                   /locus_tag="SUB0012"
FT                   /note="Signal peptide predicted for SUB0012 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.731 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             12334..13617
FT                   /transl_table=11
FT                   /locus_tag="SUB0013"
FT                   /product="PP-loop family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40337"
FT                   /db_xref="GOA:B9DSP9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSP9"
FT                   /protein_id="CAR40337.1"
FT                   /translation="MMMYTDIYNQVKAKHFFNNHTKVLIAVSGGVDSMNLLHFLHIYQE
FT                   KFEILIGIVHVNHKQRQESEIEESYLIEWAKKHNIPIYTSSFKGKFTEAKARTFRYDFF
FT                   KKIMQEEGYTALVTAHHADDQAETILMRIFRGSRLKYLSGIKEIQSFGTGELIRPFLGI
FT                   QKSQFPNIFHFEDQSNFENYYFRNRIRNHYMKEIEQENPNFKTSLLSLAKETEYLIDAL
FT                   DDLTKEIDFQQRYQFLEQTNATQFYLLQKYINTFPDLMLTRQQFDNVLHLLTTKKEGVF
FT                   PLKNGYFLKLTRDFSVIEKIGLETETKSEPVLIEYDSSKIFHSIKFSFSNDDLIPHDEI
FT                   IPIYNLSPILLRKRKEGDKIHFDHFSKKLRRLFIDEKFSHEERNKAVVGEQNNEILFVL
FT                   VAGKTYLRNAPKDGIMRAKLYVEKLRKR"
FT   misc_feature    12397..12975
FT                   /locus_tag="SUB0013"
FT                   /note="HMMPfam hit to PF01171, PP-loop family, score
FT                   4.6e-86"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   CDS             13622..14164
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SUB0014"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40338"
FT                   /db_xref="GOA:B9DSQ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ0"
FT                   /protein_id="CAR40338.1"
FT                   /translation="MLEQDIKKVLYSEEEIISKTKELGKQLTKDYQGKNPLMVGVLKGS
FT                   VPFMSELMKHIDTHVEIDFMVVSSYHGGMTSSGEVKILKDVDTNVEGRDIIFIEDIIDT
FT                   GRTLKYLRDMFKYRKANSVKIATLFDKPEGREVDIDADYVCYDVPNEFIVGFGLDYDEN
FT                   YRNLPYVGVLKEEVYTK"
FT   misc_feature    13634..14068
FT                   /gene="hpt"
FT                   /locus_tag="SUB0014"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 3.9e-35"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS             14186..16153
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SUB0015"
FT                   /product="putative cell division protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40340"
FT                   /db_xref="GOA:B9DSQ1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ1"
FT                   /protein_id="CAR40340.1"
FT                   /translation="MKNNKNNGFVKNSFIYILVIVLVITGFQYYLKGTSTQSQQINYSK
FT                   LIKQIKAGDVKSITYQPSGSIIEVRGKYEKPQKIAADPGLSFFGTGAATKVSEFTSLIL
FT                   PSDSTLKDVTSAADASGTEITIKQESSSGAWISFLMSFLPIVIFAAFMMMMMNQGGGAR
FT                   GAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKALGARIPSGV
FT                   LLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERAI
FT                   IFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNESIIVIAATNRSDVLDPA
FT                   LLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVNLKVVAQQTPGFVGADLENVL
FT                   NEAALVAARRNKTKIDASDIDEAEDRVIAGPSKKDRTISQREREMVAYHEAGHTIVGLI
FT                   LSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKDDLKEQLAGLMGGRVAEEIIFNSQ
FT                   TTGASNDFEQATQMARAMVTEYGMSDKLGPVQYEGNHAMMPGQLSPEKSYSSQTAQMID
FT                   DEVRALLNEARNRAADIINENRETHKLIAEALLKYETLDAAQIKSIFETGKMPENIDSE
FT                   DEDLHALSYEEIKDKMIEEE"
FT   misc_feature    order(14222..14278,14585..14653)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0015 by TMHMM2.0 at aa 13-31 and 134-156"
FT   misc_feature    14300..14770
FT                   /gene="ftsH"
FT                   /locus_tag="SUB0015"
FT                   /note="HMMPfam hit to PF06480, FtsH Extracellular, score
FT                   4.2e-34"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    14846..15409
FT                   /gene="ftsH"
FT                   /locus_tag="SUB0015"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various c, score 2e-91"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    14861..14884
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    15158..15214
FT                   /note="PS00674 AAA-protein family signature."
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    15425..16051
FT                   /gene="ftsH"
FT                   /locus_tag="SUB0015"
FT                   /note="HMMPfam hit to PF01434, Peptidase family M41, score
FT                   1.3e-110"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS             16258..17646
FT                   /transl_table=11
FT                   /locus_tag="SUB0016"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40343"
FT                   /db_xref="GOA:B9DSQ2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ2"
FT                   /protein_id="CAR40343.1"
FT                   /translation="MNIFRKKNNSTQKTEMRRHLTVFDLIFLGLGSMVGTGIFTITGIG
FT                   AAKYAGPALTISIILSALAIAILALFYAEFASRIPANGGAYSYVYATLGEFPAWIVGWY
FT                   IIMEFLTAISSVAVGWGSYLKGLLSSYGIHLPQALNGTFNVSKGTYIDFLPMLVMVIVT
FT                   SIVLMNSKTALRFNSILVILKFSALALFIVVGLFFIDLNNWSNFAPYGLGQLYGGKSGI
FT                   FAGASVMFFAFLGFESISMTVDEVKNPQKNVPKGIIYSLIIVTILYVVVTGILTGIVYY
FT                   KKLDVPDAVAYALREIGIGWAANYISFVAVLTLITVCISMTFALARIVYSISRDGLLPK
FT                   VLKKVTKDSFIPKNATLLVGLISMICAGVVPLASLAEFVNICTLAYLIIMSIAIIILRK
FT                   NEGLPEKGQFKTPLVPILPILAILICLSFMSQYMVGTWIAFGVSTLIGILLYIFYGFKH
FT                   SELN"
FT   sig_peptide     16258..16395
FT                   /locus_tag="SUB0016"
FT                   /note="Signal peptide predicted for SUB0016 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.738 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(16318..16386,16414..16482,16543..16611,16699..16767,
FT                   16786..16854,16897..16965,17026..17094,17179..17247,
FT                   17305..17373,17383..17451,17488..17547,17557..17625)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0016 by TMHMM2.0 at aa 21-43, 53-75, 96-118, 148-170,
FT                   177-199, 214-236, 257-279, 308-330, 350-372, 376-398,
FT                   411-430 and 434-456"
FT   misc_feature    16327..17643
FT                   /locus_tag="SUB0016"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   misc_feature    16894..16917
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   rRNA            18012..19555
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            19627..19699
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:19660..19662,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            19894..22792
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            22995..23114
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            23128..23200
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:23161..23163,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            23219..23291
FT                   /gene="tRNA-Asp"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:23252..23254,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            23365..23437
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:23398..23400,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 78.98"
FT   tRNA            23443..23524
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:23477..23479,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 42.97"
FT   tRNA            23535..23607
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:23568..23570,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            23621..23692
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:23653..23655,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            23701..23785
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:23735..23737,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 52.94"
FT   tRNA            23804..23877
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:23838..23840,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 69.55"
FT   tRNA            23884..23957
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:23918..23920,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   tRNA            23963..24036
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:23997..23999,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 72.81"
FT   tRNA            24061..24134
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:24095..24097,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 80.52"
FT   tRNA            24141..24230
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:24177..24179,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            24241..24314
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:24275..24277,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            24336..24408
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:24369..24371,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            24420..24490
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:24452..24454,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 69.41"
FT   tRNA            24523..24596
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:24557..24559,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.30"
FT   tRNA            24604..24691
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:24638..24640,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 31.75"
FT   CDS             24761..25579
FT                   /transl_table=11
FT                   /locus_tag="SUB0017"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40347"
FT                   /db_xref="GOA:B9DSQ3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ3"
FT                   /protein_id="CAR40347.1"
FT                   /translation="MYNNKFSKFFFWLFMVLIFSLMISFTFNQTVSPYLSRSSNFFISK
FT                   VDYIISRPFLVVNDCIDHSQNLFKGYSENKELKRKLKESDSFSSELKFYKSENKKLKEL
FT                   LKVTSPIQKSIIGHLMVRTPRSWADSIIVSYPSSSFINENTLVTSNDSLIGKVSDSRGN
FT                   SSRIDLLTSGKNFDLPIKIEDKQGTIYGNLKSYHSDRQLMESSEFNSDQMVTIGAKVFT
FT                   SGLDGETATDISIGTVAKIENSEDKLKRKIYIHLDGKFDDISYVYMIGKE"
FT   sig_peptide     24761..24838
FT                   /locus_tag="SUB0017"
FT                   /note="Signal peptide predicted for SUB0017 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.809) with cleavage site
FT                   probability 0.677 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    24785..24853
FT                   /note="1 probable transmembrane helix predicted for SUB0017
FT                   by TMHMM2.0 at aa 9-31"
FT   misc_feature    25109..25576
FT                   /locus_tag="SUB0017"
FT                   /note="HMMPfam hit to PF04085, rod shape-determining
FT                   protein MreC, score 5e-07"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   CDS             25583..26083
FT                   /transl_table=11
FT                   /locus_tag="SUB0018"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40349"
FT                   /db_xref="GOA:B9DSQ4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ4"
FT                   /protein_id="CAR40349.1"
FT                   /translation="MRKRFIFYLLLSIPLLLTDAHFSELLYEFSFSHFMVTSYLFVTIL
FT                   FLFCQSEYSQWSFAYAIIFGTIYDYYYFSFLGITVLSLPLFSLTAFGFKKIFSKNLSVF
FT                   QESLLYTICLFIYVIVTFLLLRNHQFINLSLSFFITYHFLPSLFFNLGIFVIFHKQLHR
FT                   FFY"
FT   misc_feature    order(25595..25648,25676..25729,25790..25858,25901..25960,
FT                   25985..26053)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0018 by TMHMM2.0 at aa 5-22, 32-49, 70-92, 107-126 and
FT                   135-157"
FT   CDS             26179..27456
FT                   /transl_table=11
FT                   /locus_tag="SUB0019"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40351"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ5"
FT                   /protein_id="CAR40351.1"
FT                   /translation="MKKRILSAVLVSGVTLGTATTVNADNFDAKIAAQDSIISNLTAEQ
FT                   AAAQSKVDALQSQIGSLQTKQSDLEAENTQLEAKSAKLSEEIQSLSSKIVARKDALEKQ
FT                   ARSAQKGTATSTYINTLLNSKSISDVVNRIVAIREVVSANAKMLNQQKADKVSLEEKQA
FT                   ANQEAINTVASNMETLAANKVSLETQQAELKVAKLDFAAQMETAEEQKASLLAQKEEAQ
FT                   KEAEAAAQAQAQAEAAAQAAAHAQAESVAKAQAQAAEVQQAPAVETPAATAVATPAPVA
FT                   QTAPQTSSVAAPVAQTAARPVAAAPVATPKPSYSSVNTYPVGQCTWGVKSLAPWVGNNW
FT                   GNGGQWAASAAAAGFSVGTTPVVGAVAVWTGGGYGHVAYVTAVESSTRIRVMESNFNGN
FT                   QYIADHRGWFNPTSTYQGAAVYIYPR"
FT   sig_peptide     26179..26250
FT                   /locus_tag="SUB0019"
FT                   /note="Signal peptide predicted for SUB0019 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.876 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    27091..27447
FT                   /locus_tag="SUB0019"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 6.6e-39"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS             27565..28524
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SUB0020"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /note="Similar to SUB0850, 53.628% identity (54.662%
FT                   ungapped) in 317 aa overlap (3-317:5-317)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40352"
FT                   /db_xref="GOA:B9DSQ6"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ6"
FT                   /protein_id="CAR40352.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASSMGIELGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEIMIMVDALKRASAETVSVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIAEYFDRHGLV
FT                   GNDVVVVSPDHGGVTRARKLAQFLHTPIAIIDKRRSVNKMNTSEVMNIIGNVSGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATEVYASCTHPVLSGPALDNIQKSAIKKLVVLDTIFL
FT                   PEERLIDKIEQISIADLIGEAIIRIHEKRPLSPLFEVD"
FT   misc_feature    27922..27951
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    27952..27999
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    27985..28386
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SUB0020"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 2.5e-35"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    28222..28260
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             28615..29793
FT                   /transl_table=11
FT                   /locus_tag="SUB0021"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40353"
FT                   /db_xref="GOA:B9DSQ7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ7"
FT                   /protein_id="CAR40353.1"
FT                   /translation="MDLSHKFNKQLYKIEISLIRQFDQSISDIPGILKLTLGEPDFTTP
FT                   DHIKEAAKDAIDANQSHYTGMSGLIELRQAVSGFLKTKYNLTYHPDNEILVTIGATEAL
FT                   SATLLAILEEGDKVLLPAPAYPGYEPIVTLAGAKMVEIDTTANHFRLTPQMLDKALKEE
FT                   GANVKAVLLNYPSNPTGVVYSREEIASFADVLKKHEVFVVSDEVYSELNYSGQGHVSIA
FT                   EYLPDQTIVINGLSKSHAMTGWRIGFICAKASITSQLIKSHQYLVTAATTMAQFAAIEA
FT                   LTKGKNDAFPMKNEYIHRRDYIISEMTKLGFSMIKPEGAFYIFAKIPEGYGHEDSFKFC
FT                   QDLARKEAVALIPGRAFGKYGEGYVRLSYAASMTTIKEAMKRLTVFMDHYGN"
FT   misc_feature    28843..29775
FT                   /locus_tag="SUB0021"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 3.2e-45"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    29314..29355
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS             29783..30556
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SUB0022"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40355"
FT                   /db_xref="GOA:B9DSQ8"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSQ8"
FT                   /protein_id="CAR40355.1"
FT                   /translation="METKKSLGLVLYNRNYREDDKLVKIFTETSGKRMFFVKNVGKSKL
FT                   ASVIQPLTIADFMMKLNEKGLSYIEDYNSVQNYPKINQDLFKLSYASYLLALADAAISD
FT                   NESDPHLFVFLKKTLDLMEEGLDYEVLTNIFEIQVLDRFGLHLNFNECVFCHRTGLPFD
FT                   FSHKYSGLLCPQHFHEDLHRSHLDPNVIYLLNQFQSIHFSDLNSISLKPEMKRKLRRFI
FT                   DVLYDDYVGIHLKSKKFIDDLDKWGDIMRTESNDS"
FT   misc_feature    29783..30514
FT                   /gene="recO"
FT                   /locus_tag="SUB0022"
FT                   /note="HMMPfam hit to PF02565, Recombination protein O,
FT                   score 1.4e-21"
FT                   /inference="protein motif:HMMPfam:PF02565"
FT   misc_feature    30236..30253
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS             30656..31663
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SUB0023"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40357"
FT                   /db_xref="GOA:B9DSQ9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSQ9"
FT                   /protein_id="CAR40357.1"
FT                   /translation="MKKIAIDAMGGDNAPQAIIEGVNRALASFKDIEIQLYGDQEKIKH
FT                   YLESEERVTIIHTDEKIDSDDEPAKAIRRKKNASMVLAAKAVKEGQADAVLSAGNTGAL
FT                   LAAGLFVVGRIKGVDRPGLMSTLPTTNQKGFDMLDLGANAENTASHLHQYAILGSFYAK
FT                   NVRGIAKPRVGLLNNGTEETKGDPLRKETYALLSQDPNIHFIGNVEARDLMSGVADVVV
FT                   ADGFTGNAVLKSIEGTALSIMKQLKSSIKGGGFKAKLGALLLKESLSDMKHSLDYSGAG
FT                   GAVLFGLKAPVVKSHGSSDANSIYYTIKQVRTMLETNVVGQLSEAFSKETISND"
FT   misc_feature    30659..31621
FT                   /gene="plsX"
FT                   /locus_tag="SUB0023"
FT                   /note="HMMPfam hit to PF02504, Fatty acid synthesis
FT                   protein, score 7.6e-136"
FT                   /inference="protein motif:HMMPfam:PF02504"
FT   CDS             31656..31901
FT                   /transl_table=11
FT                   /locus_tag="SUB0024"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40359"
FT                   /db_xref="GOA:B9DSR0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR0"
FT                   /protein_id="CAR40359.1"
FT                   /translation="MTREDLLKRLEEIINVQDPAKALLISEKTSLKDDLGVDSIELMEF
FT                   VINVEDAFSISIPDEDVETLMTIGDLIDYLQKKLAK"
FT   misc_feature    31677..31880
FT                   /locus_tag="SUB0024"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 3.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   CDS             32047..32751
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SUB0025"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40361"
FT                   /db_xref="GOA:B9DSR1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSR1"
FT                   /protein_id="CAR40361.1"
FT                   /translation="MSNQLIYTGKAKDIYTTEDEHVIKSVYKDQATMLNGARKETIVGK
FT                   GVLNNKISSLIFEKLNEAGVATHFIKKLSDTEQLNKKVDIIPLEVVLRNVTAGSFAKRF
FT                   GIVEGILLDTPIVEFYYKKDELDDPFINDEHVLFLKIADEKQIAYIKEETLRINQLLKG
FT                   WFQQIDLQLIDFKLEFGFDKDGNIILADEFSPDNCRLWDKDGNHMDKDVFRRDLGNLTA
FT                   VYQIVLEKLEQL"
FT   misc_feature    32050..32748
FT                   /gene="purC"
FT                   /locus_tag="SUB0025"
FT                   /note="HMMPfam hit to PF01259, SAICAR synthetase, score
FT                   1.3e-107"
FT                   /inference="protein motif:HMMPfam:PF01259"
FT   misc_feature    32299..32343
FT                   /note="PS01057 SAICAR synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    32560..32586
FT                   /note="PS01058 SAICAR synthetase signature 2."
FT                   /inference="protein motif:Prosite:PS01058"
FT   CDS             32804..36532
FT                   /transl_table=11
FT                   /locus_tag="SUB0026"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40363"
FT                   /db_xref="GOA:B9DSR2"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR2"
FT                   /protein_id="CAR40363.1"
FT                   /translation="MDKRIFVEKKADFQIKAQSLVKELQHKLQLETLKELRIIQVYDVF
FT                   NMSLDLVDAAEKHIFSEQVTDTLLSEEAILSDLEQFAFFAIESLPGQFDQRAASSQEAL
FT                   LLLGSANDTRVVTAQLYLVNKDIDSKELESLKRYLLNPVDSRFKDITKGIASQEFSESD
FT                   KSIPKLNFFEHFNAEDFATYKAEQGLAMEVADLLFIQDYFKSIGRVPTETELKVLDTYW
FT                   SDHCRHTTFETELKAIDFSASKFKEQLQATYDKYISMRQELGRSDKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIEVDVNGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITAPIAATRQGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVKEYFHPGFVAKRMELGAVVGAAPKENVVREKPVAGDLVILLGGKTGRDGVGG
FT                   ATGSSKVQTIESVETAGAEVQKGNAIEERKIQRLFRNGDVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLEIDLDKVPLKYQGLNGTEIAISESQERMAIVVRPEDVEQFIAECQKENIAAV
FT                   VVAEVTEKPHLVMTWNGEIIVDLDRAFLDTNGVRVEVEAKVIDHDMAVPGQRKTSLESL
FT                   ESDTLALLSDLNHSSQKGLQTLFDSSVGRSTVNHPLGGRYQMTPTESSIQKLPVQHGVT
FT                   ITASVMAQGYHPYIAEWSPYHGAAYAVVEATARLVASGADWEKARFSYQEYFQRMDKEA
FT                   ENFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADTNKVLS
FT                   PEFKEANQFVYYLAGQEISETIDFTSIKDNFKLFSSIQQKHKITAAAAVKYGGLVESLA
FT                   LMAFGNQLGAKINLDDIESSLSAQLGGFVFTSSEEIADAVKIGETQEYFALDFNGVILE
FT                   GAELLEAYEGKLEDIYPTEFEQAAELLEVPEVTNTQVIQAETVIAEPVVYIPVFPGTNS
FT                   EYDSAKAFEKEGAKVYLVPFVTLNEAAIEQSVETMVEYIEKANIIFFAGGFSAADEPDG
FT                   SAKFIVNILLNAKVRKAIDAFIAKGGLIIGICNGFQALVKSGLLPYGNFEGVHESSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLAGVSVGDIHAIPVSHGEGKFVVTTQEFISLRDNG
FT                   QIFSQYVDFEGRPSMDSRYNPNGSFHAIEGITSKNGQIIGKMGHSERYEEGLFQNIPGH
FT                   KDQSLFASAVNYFTGKQ"
FT   misc_feature    34118..34579
FT                   /locus_tag="SUB0026"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 2.3e-34"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   misc_feature    35645..35710
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1119.000, SD 3.00 at aa 962-983, sequence
FT                   TEFEQAAELLEVPEVTNTQVIQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             36566..38020
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SUB0027"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40368"
FT                   /db_xref="GOA:B9DSR3"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR3"
FT                   /protein_id="CAR40368.1"
FT                   /translation="MTHEIKSLNEECGVFGIWGHPHAAQVTYFGLHSLQHRGQEGAGIV
FT                   ANENGRLKQHRDTGLLSEVFKKQSDLDKLTGTAAIGHVRYATAGTASINNIQPFLYNFT
FT                   DEQFGLCHNGNLTNALSLKKELEREGAIFNASSDTEILMHLIRRSHHPEFMGKVKEALN
FT                   TVKGGFAYLLMTEDKLIATLDPNGFRPLSIGQMSNGAWVISSETCAFEVIGAKWVRDVL
FT                   PGEIIIIDDNGITYDTYTKDTQLAICSMEYVYFARPDSTIYGVNVHTARKNMGRRLAQE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVSLLREAGAKEVHVAIGSPELKYPCFYGID
FT                   IQTRRELISANHTVDEVCEIIGADSLTYLSLEGMIDSIGLKTDAPNGGLCVAYFDGKYP
FT                   TPLYDYEEEYLRSLEEKTSFYIEKVK"
FT   misc_feature    36599..37186
FT                   /gene="purF"
FT                   /locus_tag="SUB0027"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 4.4e-35"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    37340..37768
FT                   /gene="purF"
FT                   /locus_tag="SUB0027"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    37622..37660
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             38555..39577
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SUB0028"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40369"
FT                   /db_xref="GOA:B9DSR4"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSR4"
FT                   /protein_id="CAR40369.1"
FT                   /translation="MTEKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGIA
FT                   EKSQIIDGSKVSEGDVLLGLASSGIHSNGYSLVRRVFADYEGEAILPELEGKALKEVLL
FT                   EPTRIYVKAVLPLVKENLVNGIAHITGGGFIENVPRMFSEELAAEIWEEKVPVLPIFKA
FT                   LETYGEIKHDEMFEIFNMGIGMMLAVKAENVARVKELLDEPVYEIGRIIKKEDKSVIIK
FT                   "
FT   misc_feature    38561..39046
FT                   /gene="purM"
FT                   /locus_tag="SUB0028"
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, N-terminal dom, score 2.8e-69"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    39077..39574
FT                   /gene="purM"
FT                   /locus_tag="SUB0028"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 6.4e-44"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   CDS             39574..40128
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SUB0029"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40370"
FT                   /db_xref="GOA:B9DSR5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR5"
FT                   /protein_id="CAR40370.1"
FT                   /translation="MSKKIAVFASGNGSNFQVIAEQFQVALVFSDHRDAYVLERANKLG
FT                   VNAVAFELKEFDNKQAYEEKIVQLLDDHNIDLVCLAGYMKIVGPTLLEAYQGKMINIHP
FT                   AYLPEFPGAHGIEDAWQAGVEQSGVTIHWVDSGVDTGQIIKQVRVPRLKEDTIESFEAR
FT                   IHEAEYKLYPEVIRELLADKS"
FT   misc_feature    39580..40101
FT                   /gene="purN"
FT                   /locus_tag="SUB0029"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   9e-59"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS             40198..41745
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SUB0030"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="C-terminal region is similar to SUB0037A, 88.333%
FT                   identity (88.333% ungapped) in 60 aa overlap
FT                   (456-515:1-60)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40373"
FT                   /db_xref="GOA:B9DSR6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSR6"
FT                   /protein_id="CAR40373.1"
FT                   /translation="MTKRALISVSDKAGIVDFAQELKKLGWDIISTGGTKTALDTAGIK
FT                   TIAIDDITGFPEMMDGRVKTLHPNIHGGLLARRDLDTHLKAAQENGIELIDLVVVNLYP
FT                   FKETILRPDVTYAQAVENIDIGGPSMLRSAAKNHASVTVVVDPSDYERVLAELTEIGET
FT                   TYETRQALAAKVFRHTAAYDALIAEYFTAQVGETKPEKLTLTYDLKQEMRYGENPQQAA
FT                   DFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKERPTVVALKHMNPCGI
FT                   GQADTIEKAWDYAYEADSVSIFGGIVVLNREVDKATAEKMHPIFLEIIIAPSYSDEALA
FT                   ILTNKKKNLRILQLPFEGQAASEIEAEYTGVVGGMLVQNQDVIEEKADAWEVVTERQPS
FT                   DDEKEALEFAWRAIKYVKSNGILIANNHMTLGVGPGQTNRVASVRIAIEQAKDRLEGAA
FT                   LASDAFFPFADNIEEIAAAGIKAIIQPGGSVRDQESIDAANKHGIAMIFTGVRHFRH"
FT   misc_feature    40237..40584
FT                   /gene="purH"
FT                   /locus_tag="SUB0030"
FT                   /note="HMMPfam hit to PF02142, MGS-like domain, score
FT                   1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF02142"
FT   misc_feature    40597..41547
FT                   /gene="purH"
FT                   /locus_tag="SUB0030"
FT                   /note="HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme,
FT                   score 1.5e-137"
FT                   /inference="protein motif:HMMPfam:PF01808"
FT   CDS             complement(join(41809..42093,42097..42552))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0031"
FT                   /product="response regulator protein (pseudogene)"
FT                   /note="Similar to Streptococcus equisimilis response
FT                   regulator FasA UniProt:Q8KQN2 (246 aa) fasta scores:
FT                   E()=1.9e-31, 34.979% id in 243 aa. CDS contains a nonsense
FT                   mutation (ochre) after codon 152"
FT   misc_feature    complement(join(41824..42093,42097..42111))
FT                   /locus_tag="SUB0031"
FT                   /note="HMMPfam hit to PF04397, LytTr DNA-binding domain,
FT                   score 1.8e-25"
FT                   /inference="protein motif:HMMPfam:PF04397"
FT   CDS             42852..43082
FT                   /transl_table=11
FT                   /gene="ublA"
FT                   /locus_tag="SUB0032"
FT                   /product="putative bacteriocin"
FT                   /note="uberolysin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40379"
FT                   /db_xref="InterPro:IPR020038"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR7"
FT                   /protein_id="CAR40379.1"
FT                   /translation="MDILLELAGYTGIASGTAKKVVDAIDKGAAAFVIISIISTVISAG
FT                   ALGAVSASADFIILTVKNYISRNLKAQAVIW"
FT   misc_feature    42933..43001
FT                   /note="1 probable transmembrane helix predicted for SUB0032
FT                   by TMHMM2.0 at aa 28-50"
FT   CDS             43172..44779
FT                   /transl_table=11
FT                   /gene="ublB"
FT                   /locus_tag="SUB0033"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40380"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR8"
FT                   /protein_id="CAR40380.1"
FT                   /translation="MEEYKKYFNLICYMIKNNFNQEFYSISQEIKRKLNINFSTIPLFV
FT                   IFLIYQYSFVLLLLLALYQVRNSMIFNIIFGISMICNMILPGTIARTSTMSISKHPWIE
FT                   CLQMSNLNKEVTTKIIFWVELVNFWIHNIFMEIISLSLLIIKFKFLGILYCVLWIILVS
FT                   LIFLRTLSKNSHLSNQTIFPITSYLFNIIFSIILTYKLFEIFIGSLNQTSFSQLLKPNQ
FT                   IDHYIIIYIKKLISVFTNQVLTISVIIMALLVLKNLIYIFLKKVYKINEMKIVVKLFNK
FT                   YSDYIKELIKNFWVYRDLRQIFNIITKVDVNPLLLIFPSGIFFIITSCLYYFIRMESHI
FT                   KILISLVFISWVTLYQYNSFLIQKIPIFNISSELRNCELIKMSKHSIEELICAKKILLC
FT                   LFSLPILLCVWSIKLLLLSVGINPIILALSVISDMLMCYVSITLVLKWTYIMPNFTWKN
FT                   IFMIKQDNYDQQILQHFLLIPGRLITLFFSISFIFVNIVKIDFSIPSLILYFILNIITL
FT                   SALLFIMKRRVRDEVKRY"
FT   misc_feature    order(43292..43360,43373..43441,43538..43606,43616..43684,
FT                   43721..43789,43892..43960,44111..44179,44189..44257,
FT                   44360..44428,44438..44506,44594..44662,44672..44740)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0033 by TMHMM2.0 at aa 41-63, 68-90, 123-145, 149-171,
FT                   184-206, 241-263, 314-336, 340-362, 397-419, 423-445,
FT                   475-497 and 501-523"
FT   CDS             44760..45305
FT                   /transl_table=11
FT                   /gene="ublC"
FT                   /locus_tag="SUB0034"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40384"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSR9"
FT                   /protein_id="CAR40384.1"
FT                   /translation="MKLKGIKNQTNYIMVHLLLFFAGIIIGYLFGHIIEDIGEMPFTLR
FT                   SYQDYFSHNFSSCLLLIFIGFLTYGLLSWIPLVYNAIVFGVAIKLLLQKYTYLQVIFLF
FT                   THGIFEIPTIFLSIYLGRVFAIEFKNVIKEIFFEKQIVFCKDNFKKYSLLFLILICMLL
FT                   IAAILEENIVKIFEWRIA"
FT   misc_feature    order(44793..44861,44943..45011,45048..45116,45210..45278)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0034 by TMHMM2.0 at aa 12-34, 62-84, 97-119 and 151-173"
FT   CDS             45305..45946
FT                   /transl_table=11
FT                   /gene="ublD"
FT                   /locus_tag="SUB0035"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40386"
FT                   /db_xref="GOA:B9DSS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS0"
FT                   /protein_id="CAR40386.1"
FT                   /translation="MLEIVNLNFSYENKEVFHNATFVIKENEVVHLRGDNGVGKTTFYK
FT                   IISGIYNIEPHLSTEVYINGEKIEMENLKNYVNYLPSTPYLFDYLSGFENIDYLLALFD
FT                   MEESRDKVLDNIKKLDLFDSLDCEIFKYSLGMKAKLYIGVMIERKCPILIIDELMSNLD
FT                   KDSQNIILEKLNRKLHESNLSIVMSSHTSEFSSFEEIKQVRIVDKRFVQQ"
FT   misc_feature    45383..45913
FT                   /gene="ublD"
FT                   /locus_tag="SUB0035"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4e-15"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    45404..45427
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             45943..46209
FT                   /transl_table=11
FT                   /gene="ublE"
FT                   /locus_tag="SUB0036"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40388"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS1"
FT                   /protein_id="CAR40388.1"
FT                   /translation="MNKVIGKILLINCIISVSLTVILPTSEPIGYYLYKSYDIIFSIVN
FT                   FTLSIFLYFFIVRDKTEDVNSNRLKFLLSITFILSLLTNVVFK"
FT   misc_feature    order(45955..46014,46057..46113,46147..46203)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0036 by TMHMM2.0 at aa 5-24, 39-57 and 69-87"
FT   CDS             46237..46416
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0037A"
FT                   /product="bifunctional purine biosynthesis protein purH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase] (fragment)"
FT                   /note="Similar to the C-terminal Streptococcus agalactiae
FT                   (serotype V) bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase] UniProt:PUR9_STRA5
FT                   (EMBL:AE014193) (515 aa) fasta scores: E()=9.7e-16, 85.000%
FT                   id in 60 aa. Similar to the C-terminal region of SUB0030.
FT                   Similar to the C-terminal region of SUB0030, 88.333%
FT                   identity (88.333% ungapped) in 60 aa overlap
FT                   (1-60:456-515)"
FT   CDS             46744..47475
FT                   /transl_table=11
FT                   /locus_tag="SUB0038"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40392"
FT                   /db_xref="GOA:B9DSS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS2"
FT                   /protein_id="CAR40392.1"
FT                   /translation="MTSQRPLYMQLVDMLELKIRESMSPNDKLLSERELSEHYGVSRIT
FT                   VRLALKELEIRGLIYKKQGKGTYVSGINEPATDLSAAYSFTEEMRKQGREPKTTILSFE
FT                   KLTVTPYLSTLLDVNKGTEIFELERLRLADDKPLMLERTFLPFQKFSTLSEEMLRQKPL
FT                   YDIFSEDYHEMVRFAEEEFYASIALDYEASLLEIKKGDPVLHVIRKTYNEKNVLIEYTF
FT                   SIARADQFRYRITHQPTINKS"
FT   misc_feature    46762..46950
FT                   /locus_tag="SUB0038"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 9.9e-16"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    46828..46902
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    46831..46896
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1466.000, SD 4.18 at aa 30-51, sequence
FT                   LSERELSEHYGVSRITVRLALK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    47014..47436
FT                   /locus_tag="SUB0038"
FT                   /note="HMMPfam hit to PF07702, UbiC transcription
FT                   regulator-associated, score 1.1e-45"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   CDS             47494..48669
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SUB0039"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40394"
FT                   /db_xref="GOA:B9DSS3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS3"
FT                   /protein_id="CAR40394.1"
FT                   /translation="MFKMNKKELQELGAEMTTKEIHQQPELWQEALETFLSQKESIDAF
FT                   LKQVNESANGEKVKVIFTGAGTSEYVGNSIWNYLQTNGNRKQYLFSSIATTDLVSAPHY
FT                   YLYKEDTVILVSFARSGNSPESVAAVDLATQIVDNCFHLTITCAEEGKLAQKAITNDRN
FT                   LLLLMPSRSNDAGFAMTGSFTCMMLTALLIFDENHLDDEKNAFVQQMKKMAQHIFEKEE
FT                   DFKALTDLDFDRLVYLGSGSLAGLTREAQLKVLELTAGKIATLFDSSMGFRHGPKSFLT
FT                   DKTILIDFVNNDPYIRQYDIDILEEVKSDDIALKTLSIGQVGQSNFSGTRFDLPSELLL
FT                   PDAYLAFPIIVAAQTIALLTSVKHGNLPDTPSATGTVNRVVKGVSIHSYKG"
FT   misc_feature    47641..48072
FT                   /gene="agaS"
FT                   /locus_tag="SUB0039"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 0.032"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS             48680..49660
FT                   /transl_table=11
FT                   /gene="lacD3"
FT                   /locus_tag="SUB0040"
FT                   /product="tagatose 1,6-diphosphate aldolase 3"
FT                   /note="Similar to SUB1454, 97.214% identity (97.214%
FT                   ungapped) in 323 aa overlap (4-326:3-325); and SUB0796,
FT                   75.000% identity (75.232% ungapped) in 324 aa overlap
FT                   (4-326:3-326)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40396"
FT                   /db_xref="GOA:B9DSS4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS4"
FT                   /protein_id="CAR40396.1"
FT                   /translation="MYQITDEKRRKLEKLSHNGIISALAFDQRGALKRMMAAHQSTEPT
FT                   VEQIEELKVMVSEELTPYASSILLDPEYGLPAVKVKDEQAGLLLAYEKTGYDATTTSRL
FT                   PDCLVEWSAKRLKEAGADAVKFLLYYDVDGDQAINDQKKAYIERIGSECQAEDIPFFLE
FT                   VLTYDEKIADNGSLEFAKVKAHKVNEAMKVFSDERFGIDVLKVEVPVNMNYVEGFAEGE
FT                   AVFTREEAAQAFKEQEAASHLPYIYLSAGVSAELFQETLVFAAESGAKFNGVLCGRATW
FT                   AGSVPVYIGQGQEAARQWLRTEGFNNIDGLNKVIERTASSWELKL"
FT   misc_feature    48698..49654
FT                   /gene="lacD3"
FT                   /locus_tag="SUB0040"
FT                   /note="HMMPfam hit to PF04274, Tagatose 1,6-diphosphate
FT                   aldolase, (LacD), score 3.1e-221"
FT                   /inference="protein motif:HMMPfam:PF04274"
FT   CDS             complement(49693..50409)
FT                   /transl_table=11
FT                   /locus_tag="SUB0041"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40397"
FT                   /db_xref="GOA:B9DSS5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS5"
FT                   /protein_id="CAR40397.1"
FT                   /translation="MGNNIPKYQRIKDRLKNKILSGNYKKGDRFFTESKLIQSFQVSSI
FT                   TIIHALRELEKEGYITRKQGLGTFISRTREEKMVRYASLDKQLSQNEDVTVLSITKGND
FT                   PHYLEKLDLHKTECYYAIHRARTLDQIPYLYQISYIPHDYLLNPNADLSAYQSLYRRFY
FT                   KDFGIQLMEEAFQTYTDLSNRVPDEVKSFLQLNDQIPCVRQTKLTKARKTNRVLEYCEL
FT                   YKSWQYFSFKTASLDY"
FT   misc_feature    complement(50200..50391)
FT                   /locus_tag="SUB0041"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 2.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(50248..50295)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS             50546..52330
FT                   /transl_table=11
FT                   /locus_tag="SUB0042"
FT                   /product="putative beta-galactosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40398"
FT                   /db_xref="GOA:B9DSS6"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS6"
FT                   /protein_id="CAR40398.1"
FT                   /translation="MTSFDIKENFYLDGKPFKILSGSIHYFRVAPEAWYRSLYNLKALG
FT                   FNTVETYVPWNLHEPQKGNFHFDGLADLEGFLDLAQELGLYAIVRPSPYICAEWEFGGL
FT                   PGWLLNEPIRVRSRDPKYLKHVKDYYDVLMPKLVKRQLENGGNILMFQVENEYGSYGED
FT                   KDYLRELMTMMRQLGVTAPLFTSDGPWHATLRSGSLIEDDVLVTGNFGSKAKINFESMK
FT                   AFFKENNKKWPLMCMEFWIGWFNRWKEPIIRRDPKETIDAIMEVLEEGSINLYMFHGGT
FT                   NFGFMNGASARLQQDLPQVTSYDYDAILDEAGNPTPKYFLLQERLQKNFPNLHFDKPLE
FT                   NKTIAIKGIALTEKVNLVETLDSISTLTEAFYPVNMESLNQTTGYILYRTYLPKDNARE
FT                   RLRLIDARDRAKVYLNNRLIETQYQFEIGNDIIIEQETENNQLDILIENMGRVSYGHKL
FT                   TAPTQSKGIGRGLMADLHFVGNWQQYPLPLESIEKVDFSGSWQEGLPSFYAYDFVCDQM
FT                   GDTYLDLSQFGKGVAYINNNHLGRFWNVGPHLSLYVPESFLKLGKNRLVIFETEGQMTP
FT                   SIQFVKKPIFKDIKGDNL"
FT   misc_feature    50570..51532
FT                   /locus_tag="SUB0042"
FT                   /note="HMMPfam hit to PF01301, Glycosyl hydrolases family,
FT                   score 3.9e-181"
FT                   /inference="protein motif:HMMPfam:PF01301"
FT   CDS             52327..52815
FT                   /transl_table=11
FT                   /locus_tag="SUB0043"
FT                   /product="sugar phosphotransferase system (PTS), sorbose
FT                   subfamily, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40400"
FT                   /db_xref="GOA:B9DSS7"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS7"
FT                   /protein_id="CAR40400.1"
FT                   /translation="MTIIATRIDGRLIHGQVANLWTTKLNISRIMVIDDEIVNNDLEKT
FT                   ALKLATPAGVKLSILTVEKAANNILEGRYNSQRLMIVAKRPSYFRRLIEAGVSLEEVNV
FT                   GNMSQSSETRSVTRSINVVDQDISDFDAIQSSGTKLFAQMVPNDTPSDFMTLLNKVRQ"
FT   misc_feature    52330..52782
FT                   /locus_tag="SUB0043"
FT                   /note="HMMPfam hit to PF03830, PTS system sorbose subfamily
FT                   IIB componen, score 7.7e-71"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   CDS             52841..53722
FT                   /transl_table=11
FT                   /locus_tag="SUB0044"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   sorbose-specific family, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40402"
FT                   /db_xref="GOA:B9DSS8"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS8"
FT                   /protein_id="CAR40402.1"
FT                   /translation="MIQWWQILFLTLYSAYQILDELTLNSSAGSPVFAGFIAGIIMGDV
FT                   ETGLWIGGSLQLMVLGVGTFGGASRIDATSGAVIATAFSVAQGIKPEMAISTIAVPVAA
FT                   LMVYTDILGRFSTTYFAHRIDKHVENFNYKGIERDYLMGALPWALSRALPVFLAVALGG
FT                   GFVQTLVDGIQQVQWLADGLTLAGKMLPGLGFAILLHYLPVKRNLHYLALGFAITAMLT
FT                   TVYSNLQTAGGALATLSKDFNAAPFKGLPMIGIAVIGAALATLHYKNGQRVNVIEQKVE
FT                   VAESGEIEDDEI"
FT   misc_feature    52844..53638
FT                   /locus_tag="SUB0044"
FT                   /note="HMMPfam hit to PF03609, PTS system sorbose-specific
FT                   iic component, score 1.1e-23"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   misc_feature    order(52901..52969,52979..53047,53279..53347,53384..53452,
FT                   53471..53539,53567..53635)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0044 by TMHMM2.0 at aa 21-43, 47-69, 147-169, 182-204,
FT                   211-233 and 243-265"
FT   CDS             53709..54527
FT                   /transl_table=11
FT                   /locus_tag="SUB0045"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose/sorbose family, IID component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40404"
FT                   /db_xref="GOA:B9DSS9"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSS9"
FT                   /protein_id="CAR40404.1"
FT                   /translation="MTKSKYQLTKQDFNQINKRSLFTFQWGWNYERMQGSGYLYMILPQ
FT                   LRKIYGDNTPELKEMMRVHTQFFNTSNFFHTIITGIDLALEENEGLSSKDAVNGVKTGL
FT                   MGPFAPIGDSVFASLVPAIMGSIAAGLAKEGVWSGVTGILMWVCVQMAIAVFRWKQLEI
FT                   AYKEGTKLVTTMRDKLTSLVDAASVMGVFMVGALIATMINFRFIAAPKIGEKVIDIQDL
FT                   MNTIFPQLLPALFTGAIFWILGRKGMTPTKAIFLIIIFALAMSYFKILGV"
FT   misc_feature    53724..54518
FT                   /locus_tag="SUB0045"
FT                   /note="HMMPfam hit to PF03613, PTS system
FT                   mannose/fructose/sorbose family I, score 4.6e-101"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    order(54051..54104,54114..54182,54243..54311,54381..54440,
FT                   54465..54518)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0045 by TMHMM2.0 at aa 115-132, 136-158, 179-201,
FT                   225-244 and 253-270"
FT   CDS             54529..54936
FT                   /transl_table=11
FT                   /locus_tag="SUB0046"
FT                   /product="sugar phosphotransferase system (PTS), fructose
FT                   family, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40405"
FT                   /db_xref="GOA:B9DST0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST0"
FT                   /protein_id="CAR40405.1"
FT                   /translation="MGKKLILISHGKFCEALKDSVEMIMGPQEDILTVGLEPSEGAEDF
FT                   KEKFLNTIQDEGEVTVFADLMGGTPCNVASRLILEGTRFDLYAGMSMPMVIGFLNGQLL
FT                   GETVDYKAYAIDNTHHVNAILSSIETDDDDL"
FT   misc_feature    54535..54876
FT                   /locus_tag="SUB0046"
FT                   /note="HMMPfam hit to PF03610, PTS system fructose IIA
FT                   component, score 8e-28"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS             complement(55082..56170)
FT                   /transl_table=11
FT                   /locus_tag="SUB0048"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40407"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST1"
FT                   /protein_id="CAR40407.1"
FT                   /translation="MKFIKILLSQIVSLFLLLTISLHALETVNAAVLGDDYPIAWKSGW
FT                   GTDTWGMYRRQCTSFVAFRLNQVNGLSIPSGLGNADTWGHIARRMGYPVNDIPAVGAVA
FT                   WFDKGINGSHLAYGHVSWVAEVNGNLVTLEEYNFDAGQGPEQYHRRVINSHQVSGFIHF
FT                   KDVDTGSIPISSPMQSPRSTIPNQGSYHFTEQMPIKAQPIANSQAIAFYQAGQMVHYDK
FT                   TVIADGYQWLSYIAYSGQRRYIPIAKVTSKESSKQEDFAPGDQVTFSGVYQVTQIHGSL
FT                   LSSKDLAGGEPGPLNWLDPGPVLESNRDGQQSGDQILYPGDFFIIPGNYKVLQIHKETK
FT                   GLLIQIGNRQTWVSMNKVQKST"
FT   misc_feature    complement(55685..56059)
FT                   /locus_tag="SUB0048"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 1.8e-26"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   sig_peptide     complement(56081..56170)
FT                   /locus_tag="SUB0048"
FT                   /note="Signal peptide predicted for SUB0048 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.931 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(56241..56516)
FT                   /transl_table=11
FT                   /locus_tag="SUB0049"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40409"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST2"
FT                   /protein_id="CAR40409.1"
FT                   /translation="MEEIREAESDIFAIVTVIVFCYADLVNIKYNRKETSNIMDSQPPK
FT                   SLFYLCLFFTLLFWILNYFHLKEWQIFASLTFISSLTLLFYSKNTK"
FT   misc_feature    complement(order(56256..56309,56319..56378,56436..56489))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0049 by TMHMM2.0 at aa 10-27, 47-66 and 70-87"
FT   CDS             56703..56948
FT                   /transl_table=11
FT                   /locus_tag="SUB0051"
FT                   /product="hypothetical protein"
FT                   /note="Possible gene remnant. C-terminus is similar to the
FT                   C-terminal region of Streptococcus pyogenes hypothetical
FT                   protein UniProt:Q9RIH9 (69 aa) fasta scores: E()=0.00042,
FT                   57.500% id in 40 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40413"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST3"
FT                   /protein_id="CAR40413.1"
FT                   /translation="MLFISIHNINYQTDYRINWLSQLLLIGLYFNSEKIVDVGGWSFGE
FT                   LLGQALDRNGNGWVGLYKRTVQQYPDGPIGYEHKTE"
FT   CDS             56977..57336
FT                   /transl_table=11
FT                   /locus_tag="SUB0052"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40414"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST4"
FT                   /protein_id="CAR40414.1"
FT                   /translation="MGNLKIQDFIYGISAFIKGSLVTIPLVALFSFLFQNKYGLSHFLF
FT                   ILPMSYLPYLVKRSKSNAYLSILLMMALTSLREFLHIPKFRVTIWIIIGHLFLLVLLYL
FT                   IKKYLIKICEKNDKE"
FT   misc_feature    order(57010..57078,57091..57144,57163..57222,57235..57291)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0052 by TMHMM2.0 at aa 12-34, 39-56, 63-82 and 87-105"
FT   CDS             57454..58716
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SUB0053"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40415"
FT                   /db_xref="GOA:B9DST5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST5"
FT                   /protein_id="CAR40415.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESEGVDKVYVAPGNDGMTLDGLNLV
FT                   NIAISEHSKLIDFAKANDIAWTFIGPDDALAAGIVDDFNRAGLKAFGPSRLAAELEWSK
FT                   DYAKEIMVKYQVPTAAYGTFSDFEEAKTYILEKGAPIVVKADGLALGKGVVVAETVDQA
FT                   IDAARDMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGNKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHISQEVIDTAIESIVKPVINGMIQEGRPYLGILYCGLILTEDGPK
FT                   VIEFNARFGDPETQIILPRLTSNFAQNMTDILDQKEPEMTWLDTGVTLGVVVASNGYPL
FT                   AYDKGVELPSKTEEDIITYYAGAKFDENGQALLSNGGRVYMLVTTEDTVQAAQDKIYRE
FT                   LKNQNTEGLFYRNDIGSKALK"
FT   misc_feature    57454..57756
FT                   /gene="purD"
FT                   /locus_tag="SUB0053"
FT                   /note="HMMPfam hit to PF02844, Phosphoribosylglycinamide
FT                   synthetase, N doma, score 3.1e-41"
FT                   /inference="protein motif:HMMPfam:PF02844"
FT   misc_feature    57760..58008
FT                   /gene="purD"
FT                   /locus_tag="SUB0053"
FT                   /note="HMMPfam hit to PF02842, Phosphoribosylglycinamide
FT                   synthetase, B doma, score 6.7e-41"
FT                   /inference="protein motif:HMMPfam:PF02842"
FT   misc_feature    58009..58419
FT                   /gene="purD"
FT                   /locus_tag="SUB0053"
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase, ATP-gr, score 8.1e-82"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    58315..58338
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    58432..58710
FT                   /gene="purD"
FT                   /locus_tag="SUB0053"
FT                   /note="HMMPfam hit to PF02843, Phosphoribosylglycinamide
FT                   synthetase, C doma, score 2e-16"
FT                   /inference="protein motif:HMMPfam:PF02843"
FT   CDS             58762..59250
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SUB0054"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40417"
FT                   /db_xref="GOA:B9DST6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST6"
FT                   /protein_id="CAR40417.1"
FT                   /translation="MEAIVSIIMGSSSDWATMQKAAEVLDKFGIAYEKKVVSAHRTPDL
FT                   MFKHAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDPKMAQALADFQLEQGKLAEAMTDELN"
FT   misc_feature    58768..59244
FT                   /gene="purE"
FT                   /locus_tag="SUB0054"
FT                   /note="HMMPfam hit to PF00731, AIR carboxylase, score
FT                   1.9e-88"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS             59237..60310
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SUB0055"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40418"
FT                   /db_xref="GOA:B9DST7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST7"
FT                   /protein_id="CAR40418.1"
FT                   /translation="MSSTKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPSSRVS
FT                   EVIVAPYDDVDALRQLADRCDVLTYEFENVDADGLDAVINDGQLPQGTDLLRISQNRIT
FT                   EKDFLANKAGVKVAPYKVIKSAADLDAIDLTKNHVLKTATGGYDGHGQIVIKSADDLPK
FT                   ARKLADAADCVLEEFVHFDLEVSVIVSGNQKEFTVFPVQENIHRNNILSKTIVPARISE
FT                   ALAEKAKDMALAIAKQLNLAGTLCVEMFASKDDIMVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGLPLPVITLHAPAVMLNVLGQHVDKAQAYVQENPSAHLHLYGKLEAKHNRK
FT                   MGHVTLFRDVPDEVEEF"
FT   misc_feature    59333..59806
FT                   /gene="purK"
FT                   /locus_tag="SUB0055"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   8.5e-22"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   CDS             60624..61916
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SUB0056"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40419"
FT                   /db_xref="GOA:B9DST8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST8"
FT                   /protein_id="CAR40419.1"
FT                   /translation="MLERYSRPEMANIWSEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIRANADFNVDRILEIEKETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTQIVAEKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NQERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMLTAYENVPLWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNLTVFPEN
FT                   MIRNMGSTFGLIFSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEADEAV
FT                   TSRLTQEEIDELFNPVYYTKRVDDIFKRLGL"
FT   misc_feature    60630..61481
FT                   /gene="purB"
FT                   /locus_tag="SUB0056"
FT                   /note="HMMPfam hit to PF00206, Lyase, score 1.7e-91"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    61404..61433
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS             62014..62949
FT                   /transl_table=11
FT                   /locus_tag="SUB0057"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40420"
FT                   /db_xref="GOA:B9DST9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DST9"
FT                   /protein_id="CAR40420.1"
FT                   /translation="MQGLGLKMKELRKKKQMTREALCGDESELSVRQLARIESGQSNPS
FT                   LAKALFIAKKLGVPLSDFVNPKELDLPKRYQELKYLILRHPTYMNTDSIEERESQFDII
FT                   FEDYYADLPEEEQVLIDRLRSRFEVYQSGNSVYGQDLLLEYIDQIKKKKTYDLNDIFFI
FT                   DLYLTCGYVSSFKETLFDKGIFECFTSKLILLEEKLDFKDLFLLNNVLMTAIAVGLTLE
FT                   EYVKIRTLLNVCRRIMTITQDFQRMPIYYMYEWRYTLFHEKDFRKAPYYYQQSLLFART
FT                   HGDEYLKTMIVNAWQEDQDKVKTLESQKEI"
FT   misc_feature    62035..62202
FT                   /locus_tag="SUB0057"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS             62977..63147
FT                   /transl_table=11
FT                   /locus_tag="SUB0058"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40422"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU0"
FT                   /protein_id="CAR40422.1"
FT                   /translation="MTFMSCCFFILFVTIDKKIKGETFMFKKIHFYVTTFSFLAVALIT
FT                   FLSEKDWWHIG"
FT   misc_feature    63061..63120
FT                   /note="1 probable transmembrane helix predicted for SUB0058
FT                   by TMHMM2.0 at aa 29-48"
FT   CDS             63179..64183
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SUB0059"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40423"
FT                   /db_xref="GOA:B9DSU1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSU1"
FT                   /protein_id="CAR40423.1"
FT                   /translation="MTRILDNDLMGDEELIERTLRPQYLKEYIGQDKVKNQLSIFIEAA
FT                   KLRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAIEKAGDLVAILNDLEPG
FT                   DVLFIDEIHRMPMAVEEVLYSAMEDFYIDIMIGAGDTSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYQVDDLTEIVERTSDIFEMAIVHEAALELAKRSRGTPRIANR
FT                   LLKRVRDYAQIMGDGVITKEMTDKALEMLDVDHEGLDYVDQKILRTMIEMYNGGPVGLG
FT                   TLSVNIAEERDTVEDMYEPYLIQKGFIMRTRTGRVATEKAYRHLKYPLDTKTE"
FT   misc_feature    63182..63337
FT                   /gene="ruvB"
FT                   /locus_tag="SUB0059"
FT                   /note="HMMPfam hit to PF05496, Holliday junction DNA
FT                   helicase ruvB N-termin, score 3.2e-29"
FT                   /inference="protein motif:HMMPfam:PF05496"
FT   misc_feature    63338..63877
FT                   /gene="ruvB"
FT                   /locus_tag="SUB0059"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.4e-26"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    63353..63376
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    63926..64162
FT                   /gene="ruvB"
FT                   /locus_tag="SUB0059"
FT                   /note="HMMPfam hit to PF05491, Holliday junction DNA
FT                   helicase ruvB C-termin, score 4e-53"
FT                   /inference="protein motif:HMMPfam:PF05491"
FT   CDS             64434..64862
FT                   /transl_table=11
FT                   /locus_tag="SUB0060"
FT                   /product="putative phosphotyrosine protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40424"
FT                   /db_xref="GOA:B9DSU2"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU2"
FT                   /protein_id="CAR40424.1"
FT                   /translation="MKKICFVCLGNICRSTMAEFVMKSLDDDNSLHIESRGTSNWEHGN
FT                   PIHLGTQKILKKYDIPFDSSKTSMQILEKDLQDFDLILGMDEKNVLDLLTLSKGRWDEK
FT                   IHLFLDKGVPDPWYTGDFEETYDLVSKGCRRWLTTLGK"
FT   misc_feature    64437..64850
FT                   /locus_tag="SUB0060"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 2.9e-29"
FT                   /inference="protein motif:HMMPfam:PF01451"
FT   CDS             64867..65280
FT                   /transl_table=11
FT                   /locus_tag="SUB0061"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40426"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU3"
FT                   /protein_id="CAR40426.1"
FT                   /translation="MREQLQTLKTFFKNSNITRSKVEVISAIFLVICGLTVLTAERKSK
FT                   QVLTYNHGQIKYSGYVVNNRMNGEGQLTFENGDSYQGHFTNGQFDGKGTFKASNGWSYR
FT                   GDFKKGQADGKGVLKAKNNKVYKGTFKQGIFQK"
FT   misc_feature    64927..64986
FT                   /note="1 probable transmembrane helix predicted for SUB0061
FT                   by TMHMM2.0 at aa 21-40"
FT   misc_feature    65035..65103
FT                   /locus_tag="SUB0061"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 4.1e-05"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   misc_feature    65104..65172
FT                   /locus_tag="SUB0061"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 5.6e-05"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   misc_feature    65173..65241
FT                   /locus_tag="SUB0061"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 0.0024"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   CDS             65277..67055
FT                   /transl_table=11
FT                   /locus_tag="SUB0062"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40427"
FT                   /db_xref="GOA:B9DSU4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU4"
FT                   /protein_id="CAR40427.1"
FT                   /translation="MRIKWFSLIRVTGLFLVLIYHFFKNSFSGGFIGVDIFFTFSGYLI
FT                   TALLIDEYSKNQKIDIIGFYRRRFYRIVPPLVLMILLVMPFTFLVKSDFVASIGRQIAA
FT                   TIGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLLWGLGVWYLAKKNYDDKQF
FT                   RSLLFMISGLIFIMSFLYMFIRAFFVSNFSLIYFSSLAHIFPFFLGAMFATISGIKDTT
FT                   VRFQKNVKLWPKKYVIGVIFGAFALLFLLTLSLDFNHLFTYLFGFVLASLFAAVMIYAA
FT                   RVLNDQTPEVEEPYLLTYIAEVSYGVYLFHWPFYIIFSQLMGNGLAVFLTLFFSFLFAS
FT                   VSYYILEPFISGKKPRLFGYELDLMPYVKWGAIFGSFLILLTVGRVLTAPKIGNFEKQL
FT                   LVGALQQNQSNINQTHTIAAGDANALSDITIIGDSVALRSQNAFAKIMPGAQLDAAVSR
FT                   NFSLAYEIFDNRVESKTLSKTTVLAVGVNSLDSYQEDLQKFIKDLPKGHRLVLVSPYNA
FT                   KNLSQVAEAREYENQLAKKYSYVTIADWYKVATENPDIWEGTDGVHYSDADTKGAELYV
FT                   TTIKTAVERAAKQEAK"
FT   misc_feature    65283..66335
FT                   /locus_tag="SUB0062"
FT                   /note="HMMPfam hit to PF01757, Acyltransferase family,
FT                   score 9.9e-25"
FT                   /inference="protein motif:HMMPfam:PF01757"
FT   misc_feature    order(65289..65345,65355..65423,65481..65546,65667..65735,
FT                   65772..65840,65853..65921,65982..66041,66054..66122,
FT                   66159..66227,66255..66314,66375..66443)
FT                   /note="11 probable transmembrane helices predicted for
FT                   SUB0062 by TMHMM2.0 at aa 5-23, 27-49, 69-90, 131-153,
FT                   166-188, 193-215, 236-255, 260-282, 295-317, 327-346 and
FT                   367-389"
FT   CDS             67208..69856
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="SUB0063"
FT                   /product="aldehyde-alcohol dehydrogenase 2 [includes:
FT                   alcohol dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40428"
FT                   /db_xref="GOA:B9DSU5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU5"
FT                   /protein_id="CAR40428.1"
FT                   /translation="MVKEKITAEQKLAAAQEHVDELVQKGLVALDEFRKLNQEQVDYIV
FT                   AKASVAALDAHGILAMHAYEETGRGVFEDKATKNLFACEHVVNNMRGVKTVGVIEDDPI
FT                   TGLTKIAEPVGVICGVTPTTNPTSTAIFKSLIALKTRNPIVFGFHPSAQESSAHAAQIV
FT                   RDAAVAAGAPENCIQWISKPSMEATGALMNHDGIATILATGGNAMVRAAYSCGKPALGV
FT                   GAGNVPAYIEKSADIRQAAHDIVMSKSFDNGMVCASEQAVIIDKDIYKEFVEEFKSYKT
FT                   YFVNKKEKALLEEFCFGVKANSKDCSGAKLNADIVGKPATWIAEQAGFTVPEGTNILAA
FT                   ECAEVGEKEPLTREKLSPVIAVLKADSTDDGLKKARQMVEFNGLGHSAAIHTKDEELAK
FT                   RFGTEMKAMRIIWNSPSTFGGIGDVYNAFIPSLTLGCGSYGRNSVGDNVSAINLLNIKK
FT                   VGKRRNNMQWFKVPSKIYFERNSIQYLQTCEDIERVMIVTDKSIEKLGFVQRVIDQLNL
FT                   RRNKVTIQVFSDVEPDPDITTVHRGTEAMRAFEPDTIIALGGGSPMDAAKGMWMFYEQP
FT                   EVDFGDLVQKFMDIRKRAFKFPSLGKKAKYIGIPTTSGTGSEVTPFAVVSDKANNRKYP
FT                   LADYALTPTIAIVDPALVESVPAFIAADTGMDVLTHATEAYTSNFANDYTDGLALQAIK
FT                   LVFQYLKKSVNENDIEAREKMHNASTMAGMAFANAFLGMSHSMAHKIGGVHHTVHGRTN
FT                   AILLPYVIRYNGTRPSKTTTWPKYNYWKADEKFQDIARMLGLPASTPEEAVASYAQAVY
FT                   DLGVAVGIKMNFKDQGIDEKVWMDSLHEIALLAYEDQCSPANPRLPLVKDMEEIMADAY
FT                   YGYAERPGRLK"
FT   misc_feature    67367..67399
FT                   /note="PS00435 Peroxidases proximal heme-ligand signature."
FT                   /inference="protein motif:Prosite:PS00435"
FT   misc_feature    68621..69796
FT                   /gene="adhE"
FT                   /locus_tag="SUB0063"
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 1.9e-140"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   misc_feature    69143..69229
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    69401..69463
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00060"
FT   misc_feature    69428..69469
FT                   /note="PS00147 Arginase family signature 1."
FT                   /inference="protein motif:Prosite:PS00147"
FT   CDS             69910..70095
FT                   /transl_table=11
FT                   /locus_tag="SUB0064"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40430"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU6"
FT                   /protein_id="CAR40430.1"
FT                   /translation="MFLIEIVKIGLLDVYIECKKRYNIADKFSELIKGEKMMAERFFDV
FT                   LAMVWIGIAGTDSRWV"
FT   CDS             70212..71699
FT                   /transl_table=11
FT                   /locus_tag="SUB0065"
FT                   /product="putative threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40433"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU7"
FT                   /protein_id="CAR40433.1"
FT                   /translation="MGLIYQSTRDQCNQVSASQAILSGLASDGGLYTPIKLPKLDLNFD
FT                   DLQSASYQEIAKLIMSAFFDDFTDEELDHCISSAYDDKFDTDLIAPIVSLKDYHNLELF
FT                   HGATIAFKDMALSILPHLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEII
FT                   VFYPKHGVSKIQELQMTTQKGQNTHVIAIEGNFDDAQTEVKRMFNDQELAAKLAKQGIQ
FT                   LSSANSMNIGRLIPQVVYYVYAYAQLVKKRSIQVGDEINITVPTGNFGNILAAYYAKEI
FT                   GLPVSKLICASNENNVLTDFFTNLTYNKKRPFKVTSSPSMDILVSSNLERLIFHLLGND
FT                   SEKTKELMFKLSKDGEYQLEGIQEDIFNIFRAGFASEEETKAEIRAIFESDNYVIDPHT
FT                   AVASAVYREYQKISGDQTLTVIASTASPYKFPCVVVNSISSEFIESDFKAVEALEKLSG
FT                   VTIPKAVRGLEKAEVLHETLVATKDMQEAVEKYLGVQ"
FT   misc_feature    70458..71483
FT                   /locus_tag="SUB0065"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 1.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    70515..70559
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS             71736..73022
FT                   /transl_table=11
FT                   /locus_tag="SUB0066"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40434"
FT                   /db_xref="GOA:B9DSU8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSU8"
FT                   /protein_id="CAR40434.1"
FT                   /translation="MTYRKRILQIALPAMAENVLQMLMGVIDNYFVAHISLAAVSGVAI
FT                   ANNIITLYQALFIAMGSAISSLLARSIGQGDEGRELKYMADAIMLTLLLSIFIGLLNLV
FT                   FGRPILVALGARSQVLGNGYSYLLVVGGQMVALAMLTTLGAIVRVKGLAKIPMHVSLLT
FT                   TILNALMSGLSIYVFDLGVLGVAWSTVLSRWIGIMILASFLPMGAIIRKMKVRLNLEML
FT                   SLALPAAGERIMMRLGDLFILMIVVHLGTRIVAGNAIGESISQFNYMPGMAVATATLIP
FT                   IAQFLGSQKDDDIEPFVKEAFKLSTIIMVIFSLFIFLLSSTLIAYFTEDKIASNAARVV
FT                   LFFSMISAPATSGTLVYTAVWQGFGNSKLPFYATTIGMWFVRILLGYFLAIQLRLGLEG
FT                   VWLATAMDNSSRWFILKRQFDKREKFQAN"
FT   misc_feature    71772..72254
FT                   /locus_tag="SUB0066"
FT                   /note="HMMPfam hit to PF01554, MatE, score 6.4e-27"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    order(71823..71891,72000..72068,72105..72173,72216..72284,
FT                   72303..72362,72435..72503,72522..72590,72648..72716,
FT                   72750..72818,72846..72914)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SUB0066 by TMHMM2.0 at aa 30-52, 89-111, 124-146, 161-183,
FT                   190-209, 234-256, 263-285, 305-327, 339-361 and 371-393"
FT   misc_feature    72414..72899
FT                   /locus_tag="SUB0066"
FT                   /note="HMMPfam hit to PF01554, MatE, score 2.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS             73216..73524
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SUB0067"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40438"
FT                   /db_xref="GOA:B9DSU9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSU9"
FT                   /protein_id="CAR40438.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    73228..73515
FT                   /gene="rpsJ"
FT                   /locus_tag="SUB0067"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10p/S20e,
FT                   score 1.2e-57"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    73300..73347
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS             73629..74255
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SUB0068"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40439"
FT                   /db_xref="GOA:B9DSV0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV0"
FT                   /protein_id="CAR40439.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGSEITVESFSAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKHLAGRMG
FT                   GNRVTIQNLEIVQVIPEKNVILIKGNVPGAKKSLITIKSAVKAAK"
FT   misc_feature    73653..74231
FT                   /gene="rplC"
FT                   /locus_tag="SUB0068"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   1.6e-89"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    73926..73997
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS             74279..74902
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SUB0069"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40441"
FT                   /db_xref="GOA:B9DSV1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV1"
FT                   /protein_id="CAR40441.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDSKVLVIVEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIVNSDKLLVTKEAISTIEEVLA"
FT   misc_feature    74324..74893
FT                   /gene="rplD"
FT                   /locus_tag="SUB0069"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
FT                   family, score 4.8e-72"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS             74902..75198
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SUB0070"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40442"
FT                   /db_xref="GOA:B9DSV2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSV2"
FT                   /protein_id="CAR40442.1"
FT                   /translation="MNLYDVIKKPVITEKSMYALEEGKYTFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTVTVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   misc_feature    74902..75087
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    74911..75186
FT                   /gene="rplW"
FT                   /locus_tag="SUB0070"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L23, score
FT                   7.6e-31"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   misc_feature    75130..75177
FT                   /note="PS00050 Ribosomal protein L23 signature."
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS             75216..76049
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SUB0071"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40444"
FT                   /db_xref="GOA:B9DSV3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV3"
FT                   /protein_id="CAR40444.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKNKAGRNN
FT                   NGRITVRHQGGGHKRHYRVIDFKRNKDNVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIISGPEADIKIGNALPLANIPVGTVIHNIEMKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGSVGNEQQSLVNIGKAGRNRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIIRRRNEK"
FT   misc_feature    75339..75569
FT                   /gene="rplB"
FT                   /locus_tag="SUB0071"
FT                   /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
FT                   binding dom, score 7e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    75585..75974
FT                   /gene="rplB"
FT                   /locus_tag="SUB0071"
FT                   /note="HMMPfam hit to PF03947, Ribosomal Proteins L2,
FT                   C-terminal doma, score 5e-87"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    75867..75902
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS             76146..76424
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SUB0072"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40446"
FT                   /db_xref="GOA:B9DSV4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV4"
FT                   /protein_id="CAR40446.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   misc_feature    76152..76394
FT                   /gene="rpsS"
FT                   /locus_tag="SUB0072"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19, score
FT                   2.9e-51"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    76302..76376
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS             76440..76784
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SUB0073"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40447"
FT                   /db_xref="GOA:B9DSV5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV5"
FT                   /protein_id="CAR40447.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVAEK"
FT   misc_feature    76464..76778
FT                   /gene="rplV"
FT                   /locus_tag="SUB0073"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22p/L17e,
FT                   score 1.5e-59"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    76698..76772
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS             76797..77450
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SUB0074"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40449"
FT                   /db_xref="GOA:B9DSV6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV6"
FT                   /protein_id="CAR40449.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFIQKE
FT                   LAEASVSTIEIERAINKVIVSLHTAKPGMVIGKGGANVDALRAQLNKLTGKQVHINIIE
FT                   IKSPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    76800..76979
FT                   /gene="rpsC"
FT                   /locus_tag="SUB0074"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein S3,
FT                   N-terminal domai, score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    76980..77144
FT                   /gene="rpsC"
FT                   /locus_tag="SUB0074"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 4.4e-23"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    77148..77399
FT                   /gene="rpsC"
FT                   /locus_tag="SUB0074"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein S3,
FT                   C-terminal domai, score 2.3e-50"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    77280..77384
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS             77454..77867
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SUB0075"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40451"
FT                   /db_xref="GOA:B9DSV7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV7"
FT                   /protein_id="CAR40451.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVSPVKRGKVMF
FT                   EIAGVSEEVAREAFRLAGHKLPVKVKFVKREAE"
FT   misc_feature    77454..77849
FT                   /gene="rplP"
FT                   /locus_tag="SUB0075"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16, score
FT                   3.6e-81"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    77628..77663
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    77697..77732
FT                   /note="PS00701 Ribosomal protein L16 signature 2."
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS             77877..78083
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SUB0076"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40454"
FT                   /db_xref="GOA:B9DSV8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV8"
FT                   /protein_id="CAR40454.1"
FT                   /translation="MKLEEIKKFVAELRGLSQEELAKKENELKKELFDLRFQAAAGQLD
FT                   QTARLNEVKKQIARVKTVQSEMK"
FT   misc_feature    77904..78077
FT                   /gene="rpmC"
FT                   /locus_tag="SUB0076"
FT                   /note="HMMPfam hit to PF00831, Ribosomal L29 protein, score
FT                   1.8e-28"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   CDS             78111..78371
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SUB0077"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40455"
FT                   /db_xref="GOA:B9DSV9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSV9"
FT                   /protein_id="CAR40455.1"
FT                   /translation="MERNQRRTLVGRVVSDKMDKTITVIVETKRNHPVYGKRINYSKKY
FT                   KAHDEKNIAKEGDIVRIMETRPLSATKHFRLVEVLEEAVII"
FT   misc_feature    78141..78347
FT                   /gene="rpsQ"
FT                   /locus_tag="SUB0077"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17, score
FT                   1.7e-35"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    78279..78317
FT                   /note="PS00056 Ribosomal protein S17 signature."
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS             78396..78764
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SUB0078"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40456"
FT                   /db_xref="GOA:B9DSW0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW0"
FT                   /protein_id="CAR40456.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   EMREAGYMKIVSLAPEVL"
FT   misc_feature    78396..78761
FT                   /gene="rplN"
FT                   /locus_tag="SUB0078"
FT                   /note="HMMPfam hit to PF00238, Ribosomal protein L14p/L23e,
FT                   score 2.5e-77"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    78573..78653
FT                   /note="PS00049 Ribosomal protein L14 signature."
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS             78848..79153
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SUB0079"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40457"
FT                   /db_xref="GOA:B9DSW1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW1"
FT                   /protein_id="CAR40457.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVVVEGVGMIKKHQ
FT                   KPNAENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   misc_feature    78854..78955
FT                   /gene="rplX"
FT                   /locus_tag="SUB0079"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.9e-09"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    78863..78916
FT                   /note="PS01108 Ribosomal protein L24 signature."
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS             79177..79719
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SUB0080"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40458"
FT                   /db_xref="GOA:B9DSW2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW2"
FT                   /protein_id="CAR40458.1"
FT                   /translation="MANRLKEKYTNEVIPALSEKFNYTTVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELELISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   misc_feature    79249..79419
FT                   /gene="rplE"
FT                   /locus_tag="SUB0080"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   6.8e-29"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    79348..79398
FT                   /note="PS00358 Ribosomal protein L5 signature."
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    79429..79713
FT                   /gene="rplE"
FT                   /locus_tag="SUB0080"
FT                   /note="HMMPfam hit to PF00673, ribosomal L5P family
FT                   C-terminus, score 7.6e-53"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS             79735..79920
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SUB0081"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40461"
FT                   /db_xref="GOA:B9DSW3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW3"
FT                   /protein_id="CAR40461.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   misc_feature    79747..79914
FT                   /gene="rpsN"
FT                   /locus_tag="SUB0081"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 3e-19"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    79801..79869
FT                   /note="PS00527 Ribosomal protein S14 signature."
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS             80076..80474
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SUB0082"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40462"
FT                   /db_xref="GOA:B9DSW4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW4"
FT                   /protein_id="CAR40462.1"
FT                   /translation="MVMTDPIADFLTRIRNANLAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGQNGERVITNLKRISKPGLRVYSKREDVPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   misc_feature    80088..80471
FT                   /gene="rpsH"
FT                   /locus_tag="SUB0082"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   3.5e-76"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    80379..80432
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS             80641..81177
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SUB0083"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40465"
FT                   /db_xref="GOA:B9DSW5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW5"
FT                   /protein_id="CAR40465.1"
FT                   /translation="MSRIGNKIITMPAGVELKNDNNVVTVKGPKGELTREFNKNIEIKV
FT                   EGTEITVSRPNDSKEMKTIHGTTRALLNNMVQGVSEGFKKELEMKGVGYRAQLQGNKLV
FT                   LSVGKSHQDEVEAPEGITFTVATPTTIAVEGISKELVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   misc_feature    80671..80886
FT                   /gene="rplF"
FT                   /locus_tag="SUB0083"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.9e-25"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80908..81135
FT                   /gene="rplF"
FT                   /locus_tag="SUB0083"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.7e-30"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    81100..81126
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS             81266..81631
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SUB0084"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40467"
FT                   /db_xref="GOA:B9DSW6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSW6"
FT                   /protein_id="CAR40467.1"
FT                   /translation="MKIVISKPDKNKTRQKRHRRVRGKLSGTAERPRLNVFRSNTGIYA
FT                   QVIDDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYH
FT                   GRVKALADAARENGLKF"
FT   misc_feature    81290..81628
FT                   /gene="rplR"
FT                   /locus_tag="SUB0084"
FT                   /note="HMMPfam hit to PF00861, Ribosomal L18p/L5e family,
FT                   score 1.6e-58"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS             81650..82144
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SUB0085"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40469"
FT                   /db_xref="GOA:B9DSW7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSW7"
FT                   /protein_id="CAR40469.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNLVEVPMVGTTIPHEVFVNYGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGIADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGVSVSDL
FT                   A"
FT   misc_feature    81674..81874
FT                   /gene="rpsE"
FT                   /locus_tag="SUB0085"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein S5,
FT                   N-terminal domai, score 7.8e-42"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    81728..81826
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    81899..82120
FT                   /gene="rpsE"
FT                   /locus_tag="SUB0085"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein S5,
FT                   C-terminal domai, score 7.7e-35"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS             82159..82341
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SUB0086"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40470"
FT                   /db_xref="GOA:B9DSW8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW8"
FT                   /protein_id="CAR40470.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVKALGLGKLNSSVIKEDNAAMRG
FT                   MVTAISHLVTVEEVK"
FT   misc_feature    82162..82320
FT                   /gene="rpmD"
FT                   /locus_tag="SUB0086"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein L30p/L7e,
FT                   score 5.9e-15"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   misc_feature    82222..82320
FT                   /note="PS00634 Ribosomal protein L30 signature."
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS             82464..82904
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SUB0087"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40471"
FT                   /db_xref="GOA:B9DSW9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSW9"
FT                   /protein_id="CAR40471.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKSRSGGG
FT                   VRLGFEGGQTPLFRRMPKRGFSNINTKEYALVNLDQLNVFEDGTEVTPVVLKEAGIVRA
FT                   EKSGVKILGNGELTKKLTVKAAKFSKSAEAAITAKGGSIEVI"
FT   misc_feature    82464..82769
FT                   /gene="rplO"
FT                   /locus_tag="SUB0087"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15 amino
FT                   terminal re, score 3.3e-56"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    82791..82886
FT                   /gene="rplO"
FT                   /locus_tag="SUB0087"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15, score
FT                   2.9e-11"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    82791..82883
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS             82921..84225
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SUB0088"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40475"
FT                   /db_xref="GOA:B9DSX0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSX0"
FT                   /protein_id="CAR40475.1"
FT                   /translation="MFLKILKDALKVKTVRHKILYTIFIILVFRIGTHITVPGVNAKSL
FT                   EQLSDLPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFVQSIGITAGFNTLSSVALVSTPNVKTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPNAIATVHEDYFVNVKSGDVQSSYLVVGIL
FT                   ILAVLAIVFFTTFVQQAEYKIPIQYTKLVQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTLIPFFQNGRDIPWLTKLQELLNYQTPTGMIVYAFLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEQYMSSLLKKLATVGSIFLAFISLAPIAAQQTLNLSSGIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   misc_feature    order(82978..83046,83116..83184,83269..83337,83365..83424,
FT                   83443..83511,83569..83628,83719..83787,83830..83898,
FT                   84022..84081,84094..84162)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SUB0088 by TMHMM2.0 at aa 20-42, 66-88, 117-139, 149-168,
FT                   175-197, 217-236, 267-289, 304-326, 368-387 and 392-414"
FT   misc_feature    83125..84168
FT                   /gene="secY"
FT                   /locus_tag="SUB0088"
FT                   /note="HMMPfam hit to PF00344, eubacterial secY protein,
FT                   score 5.4e-161"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    83125..83184
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:Prosite:PS00755"
FT   misc_feature    83416..83472
FT                   /note="PS00756 Protein secY signature 2."
FT                   /inference="protein motif:Prosite:PS00756"
FT   misc_feature    83440..83496
FT                   /note="PS00095 C-5 cytosine-specific DNA methylases
FT                   C-terminal signature."
FT                   /inference="protein motif:Prosite:PS00095"
FT   CDS             84364..85005
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SUB0089"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40476"
FT                   /db_xref="GOA:B9DSX1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSX1"
FT                   /protein_id="CAR40476.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVIHISTGDMFRAAMANQTEM
FT                   GLLAKSYIDKGDLVPDEVTNGIVKERLSQDDIKEKGFLLDGYPRTIDQAHALDATLADL
FT                   GLKLNGVVNIDVDPNSLVERLSGRIIHKKTGETFHKIFNPPAGDYDENDYYQREDDKPE
FT                   TVKRRLDVNIAQGQPIIDHYRKSGIVHDIQGNQEISEVFVDIKKVIESLA"
FT   misc_feature    84376..84927
FT                   /gene="adk"
FT                   /locus_tag="SUB0089"
FT                   /note="HMMPfam hit to PF00406, Adenylate kinase, score
FT                   2.1e-87"
FT                   /inference="protein motif:HMMPfam:PF00406"
FT   misc_feature    84607..84642
FT                   /note="PS00113 Adenylate kinase signature."
FT                   /inference="protein motif:Prosite:PS00113"
FT   CDS             85124..85342
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SUB0090"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40479"
FT                   /db_xref="GOA:B9DSX2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSX2"
FT                   /protein_id="CAR40479.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   misc_feature    85127..85339
FT                   /gene="infA"
FT                   /locus_tag="SUB0090"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   3e-13"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS             85368..85484
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SUB0091"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40481"
FT                   /db_xref="GOA:B9DSX3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSX3"
FT                   /protein_id="CAR40481.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   misc_feature    85368..85481
FT                   /gene="rpmJ"
FT                   /locus_tag="SUB0091"
FT                   /note="HMMPfam hit to PF00444, Ribosomal protein L36, score
FT                   2.2e-17"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   misc_feature    85398..85478
FT                   /note="PS00828 Ribosomal protein L36 signature."
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS             85502..85867
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SUB0092"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40482"
FT                   /db_xref="GOA:B9DSX4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSX4"
FT                   /protein_id="CAR40482.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   KDLTSDQEDAIRREIDSIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKATAIAGKKK"
FT   misc_feature    85508..85825
FT                   /gene="rpsM"
FT                   /locus_tag="SUB0092"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein S13/S18,
FT                   score 2.3e-54"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    85760..85801
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS             85885..86268
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SUB0093"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40484"
FT                   /db_xref="GOA:B9DSX5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSX5"
FT                   /protein_id="CAR40484.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    85933..86262
FT                   /gene="rpsK"
FT                   /locus_tag="SUB0093"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11, score
FT                   2.1e-72"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    86167..86235
FT                   /note="PS00054 Ribosomal protein S11 signature."
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS             86314..87252
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SUB0094"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40486"
FT                   /db_xref="GOA:B9DSX6"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSX6"
FT                   /protein_id="CAR40486.1"
FT                   /translation="MIEFEKPTITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKFDGVLHEFDTIPGVREDVMQIILNIKGLAVKSYVEDEKMIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLKATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATDVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   misc_feature    86353..86985
FT                   /gene="rpoA"
FT                   /locus_tag="SUB0094"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11
FT                   dimerisation, score 7.5e-22"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    86473..86820
FT                   /gene="rpoA"
FT                   /locus_tag="SUB0094"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA
FT                   insert domain, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    87019..87222
FT                   /gene="rpoA"
FT                   /locus_tag="SUB0094"
FT                   /note="HMMPfam hit to PF03118, Bacterial RNA polymerase,
FT                   alpha chain C, score 1.2e-31"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS             87267..87653
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SUB0095"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40489"
FT                   /db_xref="GOA:B9DSX7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSX7"
FT                   /protein_id="CAR40489.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTSALQKLFNEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    87312..87650
FT                   /gene="rplQ"
FT                   /locus_tag="SUB0095"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17, score
FT                   2.7e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    87354..87422
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:Prosite:PS01167"
FT   rRNA            88250..89793
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            89865..89937
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:89898..89900,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            90132..93030
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            93233..93352
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            93366..93438
FT                   /gene="tRNA-Val"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:93399..93401,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            93448..93518
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:93480..93482,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 69.41"
FT   tRNA            93550..93623
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:93584..93586,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.30"
FT   tRNA            93640..93711
FT                   /gene="tRNA-Glu"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:93673..93675,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   tRNA            93717..93806
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:93753..93755,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            93817..93890
FT                   /gene="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:93851..93853,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            93912..93984
FT                   /gene="tRNA-Phe"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:93945..93947,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            94002..94082
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:94036..94038,aa:Tyr)"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 55.90"
FT   tRNA            94088..94158
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:94120..94122,aa:Trp)"
FT                   /note="tRNA Trp anticodon CCA, Cove score 50.14"
FT   tRNA            94170..94242
FT                   /gene="tRNA-His"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:94203..94205,aa:His)"
FT                   /note="tRNA His anticodon GTG, Cove score 61.82"
FT   tRNA            94251..94322
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:94283..94285,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 54.64"
FT   tRNA            94345..94428
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:94379..94381,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAA, Cove score 63.35"
FT   CDS             join(94502..94675,94674..94925)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0096"
FT                   /product="AraC family regulatory protein (fragment)"
FT                   /note="Gene remnant. Similar to an internal region of
FT                   Fusobacterium nucleatum (subsp. nucleatum) transcriptional
FT                   regulator, AraC family UniProt:Q8RGI0_FUSNN (EMBL:AE010544)
FT                   (281 aa) fasta scores: E()=1.2e-19, 48.062% id in 129 aa"
FT   CDS             complement(95099..95620)
FT                   /transl_table=11
FT                   /locus_tag="SUB0098"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40493"
FT                   /db_xref="GOA:B9DSX8"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSX8"
FT                   /protein_id="CAR40493.1"
FT                   /translation="MKKTFTSTLVLLSALMLTACSESNTGKSISEDKATDIVLKDAKLT
FT                   KKEVSNFQIKSDKEDGKATYEIDFDTDKKEYDYTVNAETGKILEKSTDSKGLSGAKDLT
FT                   KDAISQDKAKSIVLKDANVKEEDTSMMSIEKDMDGTTSTYEVTFTANNKEYEYTVNAKS
FT                   GEIMEKSSEN"
FT   misc_feature    complement(95111..95302)
FT                   /locus_tag="SUB0098"
FT                   /note="HMMPfam hit to PF03413, Peptidase propeptide and
FT                   YPEB domain, score 1.6e-07"
FT                   /inference="protein motif:HMMPfam:PF03413"
FT   misc_feature    complement(95348..95539)
FT                   /locus_tag="SUB0098"
FT                   /note="HMMPfam hit to PF03413, Peptidase propeptide and
FT                   YPEB domain, score 3e-07"
FT                   /inference="protein motif:HMMPfam:PF03413"
FT   sig_peptide     complement(95558..95620)
FT                   /locus_tag="SUB0098"
FT                   /note="Signal peptide predicted for SUB0098 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.483 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(95561..95593)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             96231..96719
FT                   /transl_table=11
FT                   /locus_tag="SUB0099"
FT                   /product="pyridoxamine 5'-phosphate oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40495"
FT                   /db_xref="GOA:B9DSX9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSX9"
FT                   /protein_id="CAR40495.1"
FT                   /translation="MIYLRKALTGEFIMELNEIMQIIEDMKVGVFATIDKNGNPHARHA
FT                   HITAATEEGIFFMTSPKTHFYEQLTNNQRIALTAMVEDGYLSQVIRIEGLARPVENDYL
FT                   KKVFANNPYYDYIYKDESSDSMQVFQIYDGDGFYHSLTQGHKYVYSVGRQGESYVRAI"
FT   misc_feature    96276..96539
FT                   /locus_tag="SUB0099"
FT                   /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
FT                   oxidase, score 8.1e-10"
FT                   /inference="protein motif:HMMPfam:PF01243"
FT   CDS             97054..97371
FT                   /transl_table=11
FT                   /locus_tag="SUB0100"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40497"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY0"
FT                   /protein_id="CAR40497.1"
FT                   /translation="MKNILELFFGLVDLAFLAAFVYFSFMGNIDTVKAVGALYVVSFHD
FT                   VDYQIDLTEKKKRVGKVRIVSKTSNDNSYNVQSKMNNKILREFLMQEYGLNKHQVVVAI
FT                   G"
FT   sig_peptide     97054..97155
FT                   /locus_tag="SUB0100"
FT                   /note="Signal peptide predicted for SUB0100 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.679) with cleavage site
FT                   probability 0.661 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    97072..97140
FT                   /note="1 probable transmembrane helix predicted for SUB0100
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS             97545..98591
FT                   /transl_table=11
FT                   /locus_tag="SUB0101"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Similar to SUB1076, 55.714% identity (56.686%
FT                   ungapped) in 350 aa overlap (1-348:1-346)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40500"
FT                   /db_xref="GOA:B9DSY1"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY1"
FT                   /protein_id="CAR40500.1"
FT                   /translation="MKATIFQEAGLVHVEEIAKPVIQENDDVIIKVVRACVCGSDLWAY
FT                   SHGDKKAAHSINDGHEALGIVEEVGSEITTVQPGDFVIVPFTHGCGECDACRAGFDGTC
FT                   DNHPGYSNWSNGFQSEYIRFHYGNWALVKVPGQPTDYSEDMIKSLLTLADVMPTGYHAA
FT                   RCAQVSAGDKVVVIGDGAVGQCAVIAAKMMGASQIILMSRHKDRQEMALASGATAVVAE
FT                   RGEEGIAKVREILGGGADAALECVGTEAAMDQALGVLHNGGRVGFVGVPHYNNRALGST
FT                   FAQNISVAGGSASVTTYDKNVLLKAVLDGDINPGRVFTQTYALSDVNQAYKDMQERKTI
FT                   KSMLIIAE"
FT   misc_feature    97563..98582
FT                   /locus_tag="SUB0101"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 1.4e-68"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    97719..97763
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS             98802..99701
FT                   /transl_table=11
FT                   /locus_tag="SUB0102"
FT                   /product="UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40502"
FT                   /db_xref="GOA:B9DSY2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY2"
FT                   /protein_id="CAR40502.1"
FT                   /translation="MTIPVFLELVEMKAKTASVLPFLIGLCFSYYYYDSVHPLIVFIFF
FT                   VAMFFFNMFVDMWDNYNDYKNAVNLDYQAQTNIIGREHLSIAFIEKLMFVFVAISAFLG
FT                   IILTLWVGWPVLFMGLFCFAVGILYSYGPRPLSSLPLGEFFSGFTMGFMISLICVYLNT
FT                   YQRFSWDLETLGNIFLISLPNTLWIANLMLANNLCDKEEDESNHRYTLVHYTGVKGGLL
FT                   LFSLSNGVAMIAIVLEFLFGLAPITVLFCLLLIPFIVKQTKLLWEKQVKRETFICAVRI
FT                   LALGSITQVVSYLIGIIF"
FT   misc_feature    98844..99680
FT                   /locus_tag="SUB0102"
FT                   /note="HMMPfam hit to PF01040, UbiA prenyltransferase
FT                   family, score 5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF01040"
FT   misc_feature    order(98907..98966,99051..99119,99129..99197,99216..99284,
FT                   99327..99395,99432..99500,99510..99578,99627..99695)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0102 by TMHMM2.0 at aa 36-55, 84-106, 110-132, 139-161,
FT                   176-198, 211-233, 237-259 and 276-298"
FT   CDS             99734..100945
FT                   /transl_table=11
FT                   /locus_tag="SUB0103"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40504"
FT                   /db_xref="GOA:B9DSY3"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY3"
FT                   /protein_id="CAR40504.1"
FT                   /translation="MQEVLVLGAGYAGLKTVRQLQKQSGDFHITLVDRNEYHYEATELH
FT                   EVASGSQPKEKISFSIKDVINPKKVTFIQDDVVKVNPESNTVELKANGTLHYDYVVVAL
FT                   GFCSETFGISGAKENALEMVDIKSAENIHRHILKMMEKYRETKDKNYLRLLICGAGFTG
FT                   IELAGALVDERKRYAEIAGVSENQIEIICVEAATRILPMFDDEMAQYGVDLIKKLGVQL
FT                   MLGSMIKEIKPGEVVYVTSPDEDAERHSIVAETIIWTTGVSGSPVMAESGFAERRGRVI
FT                   VNNDLRDPKYDNVYILGDVSALMDSESNRPYPTTAQIATRMGAHAAKNLLLQLKGEAPV
FT                   DFNYKSLGTVASVGNTHAFGLVGSSKIKGYPASVAKKGIMNKSLIEMGGLKELLAKGRF
FT                   DLYH"
FT   misc_feature    99740..100645
FT                   /locus_tag="SUB0103"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreducta, score 5e-23"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   CDS             101027..102454
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="SUB0104"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40505"
FT                   /db_xref="GOA:B9DSY4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY4"
FT                   /protein_id="CAR40505.1"
FT                   /translation="MTIETLARFQFAMTTVFHFFFVPFTIGTCFVVAIMETLYVVTKNE
FT                   EYKKMTKFWGNIMLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAIEALLAFF
FT                   MESTFLGLWMFTWDNKKISKKLHVTFIWLVVFGSLMSAMWILIANSFMQHPVGYEVVNG
FT                   RAQMTDFFALINNHQFRYEFGHVITGAITMGGIVIAGMSAFKLLKKEELTESVQKIYKK
FT                   SLRLGLLVSLLGSISVMGVGDLQMKALINDQPMKFAAMEGDYEDSGDPAAWTVIAWANE
FT                   AKKEQVFGIKIPYMLSILSYGKPSGSVKGMDTANKELVAKYGQDNYFPMVNLLFYGFRT
FT                   MAAFGTMMLGVSALGLFLTRPKKPILYDHKWMLAIVALTTVAPFLSNTFGWIITEQGRY
FT                   PWTVYGLFKIKDSVSPNVSVASLLFSNTVYFLLFSCLGAMMVYLVIRELQKGPEHEEVL
FT                   LQGLAKSSVDPFEKGAF"
FT   misc_feature    101042..102406
FT                   /gene="cydA"
FT                   /locus_tag="SUB0104"
FT                   /note="HMMPfam hit to PF01654, Bacterial Cytochrome
FT                   Ubiquinol Oxidase, score 1.4e-155"
FT                   /inference="protein motif:HMMPfam:PF01654"
FT   misc_feature    order(101084..101152,101186..101254,101297..101365,
FT                   101402..101470,101567..101635,101696..101764,
FT                   102032..102100,102137..102205,102293..102361)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0104 by TMHMM2.0 at aa 20-42, 54-76, 91-113, 126-148,
FT                   181-203, 224-246, 336-358, 371-393 and 423-445"
FT   CDS             102454..103473
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SUB0105"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40507"
FT                   /db_xref="GOA:B9DSY5"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY5"
FT                   /protein_id="CAR40507.1"
FT                   /translation="MSGLQFFWFFLIGLLFSGFFFLEGFDFGVGMAVQTLAHNEEEKDQ
FT                   IVSTIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLILFAILFGLIIRGVSFEFR
FT                   HNVPARQKNIWNWTLSIGSAMVPFFFGIMFVSLVQGMPLDAKANMSAQFGDYFNLFSIV
FT                   GGVAMVLLAYLHGLNYIALKTEGPVRSRANNYAQLLYWVLYLGLVAFAVLLFFKTDFFT
FT                   HHALSTLVLLIVIVALTVFAHISVFKAAEMSAFLASGLSLVTVVVLLFQGLFPRVMISS
FT                   ISSKYDLLIENASSSPYTLKIMSIIAISLVPFVLAYTAWAYYIFRKRITLPVVMTGEK"
FT   misc_feature    102457..103443
FT                   /gene="cydB"
FT                   /locus_tag="SUB0105"
FT                   /note="HMMPfam hit to PF02322, Cytochrome oxidase subunit
FT                   II, score 5.7e-114"
FT                   /inference="protein motif:HMMPfam:PF02322"
FT   misc_feature    order(102472..102540,102688..102756,102793..102861,
FT                   102919..102987,103045..103098,103126..103194,
FT                   103207..103275,103357..103425)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0105 by TMHMM2.0 at aa 7-29, 79-101, 114-136, 156-178,
FT                   198-215, 225-247, 252-274 and 302-324"
FT   CDS             103473..105191
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="SUB0106"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /product="transport ATP-binding protein CydC"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40508"
FT                   /db_xref="GOA:B9DSY6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY6"
FT                   /protein_id="CAR40508.1"
FT                   /translation="MLDKAVMRLSGIHKLLGLLAGLDFLQAIFIIGQAYYLSHAITGLW
FT                   QGLGLQRQVMSILFFSLSYLGRHLINYVKDNMLDRFSAHHAKELRQQLLHKLFQLGPHI
FT                   VQEKGSGNVITMALDGISLIENYLHLVLNKMMNMSVIPFVILAFIFYLDLESGIILLLV
FT                   FPLIILFMVILGLAAKAKADKQYASYQILSNHFLDSLRGIDTLRFFGLSKRYAKSIYTS
FT                   SEAFRKATMSALRIGILSTFALDFFTTLSIAIVAVMLGLRLINEQMLLFPALTVLILAP
FT                   EYFIPVRDFSNDYHATLDGKNAFQAVQSILQKEDFLQEPVLLPEWQENSQLLLQEISLS
FT                   YGNQKVLDIPQLKVEGLQKVGIVGMSGSGKSSLINLLSGFISPSTGNFQINGTPLSNMN
FT                   QEAWRKQLVYIPQSPYVFEMSLADNIRFYTPNASQEMVEEAVSVVGLTELVKELPNGLN
FT                   TIIGNGARPLSGGQAQRIALARAFLDKQRNILLFDEPTAHLDIETELELKEQMLPLMAN
FT                   KLVLFATHRLHWLKEMDTILVIQDGKIVEEGTYQDLLAQKGALYQLKNAMGGNHD"
FT   misc_feature    103479..104345
FT                   /gene="cydC"
FT                   /locus_tag="SUB0106"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 3.6e-05"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    order(103506..103574,103617..103685,103860..103928,
FT                   103938..104006,104178..104246)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0106 by TMHMM2.0 at aa 12-34, 49-71, 130-152, 156-178
FT                   and 236-258"
FT   misc_feature    104541..105098
FT                   /gene="cydC"
FT                   /locus_tag="SUB0106"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8.5e-51"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    104562..104585
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    104874..104918
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             105184..106929
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="SUB0107"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40509"
FT                   /db_xref="GOA:B9DSY7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY7"
FT                   /protein_id="CAR40509.1"
FT                   /translation="MIKIPIVKEFENDQWVKPYFKQYRKSLLLALLLGFLTFFAASALM
FT                   FNSGFLISKSASLPSNILLVYIPIVLTRAFGIGRPVFRYLERLTSHNWVLKMTSKLRLK
FT                   LYTRLEEDAVFLKQKHRLGDIMGLLAEDINHIQNLYLRTIFPTVIAWVFYIFIVIGLGF
FT                   FSWWFALLILIYLGVLVFVFPLWSVLINGARQQKEKLLKNRLYTDLTDNVLGISDWIFS
FT                   QRGQEYVHSHEKTEKELASIQAKMRRFNHFRNLLFELAFGLLTILVLIWASYQFPGKNG
FT                   GAANWIAAFVLSVFPLIDAFVGLSSAAQETNSYADSLHRLNELPEKTQSLATAEKPKAP
FT                   YDLVIENLSFSYDQTSKPVLKDLSLTIPQGHRLAILGASGSGKSTLASLLRGDLLPSCG
FT                   QVKLSGIPVNDLRETISDYIGVIQQAPYLFNTSLLNNIRIGNQEATEEDVWQVLERVGL
FT                   KAMVEKLPHGLATMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTVGLDPVTEKR
FT                   LLDTFMEVLKGKTLIWITHHLKGIEHADQVIFIEKGQLELSGSPQELLTTSQRYRQLKA
FT                   IDDGL"
FT   sig_peptide     105184..105354
FT                   /gene="cydD"
FT                   /locus_tag="SUB0107"
FT                   /note="Signal peptide predicted for SUB0107 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.818) with cleavage site
FT                   probability 0.449 between residues 57 and 58"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    105250..106086
FT                   /gene="cydD"
FT                   /locus_tag="SUB0107"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 0.00045"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    order(105259..105318,105346..105414,105613..105681,
FT                   105694..105762,105943..106011,106039..106107)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0107 by TMHMM2.0 at aa 26-45, 55-77, 144-166, 171-193,
FT                   254-276 and 286-308"
FT   misc_feature    106291..106842
FT                   /gene="cydD"
FT                   /locus_tag="SUB0107"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.8e-52"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    106312..106335
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(106961..107941)
FT                   /transl_table=11
FT                   /locus_tag="SUB0108"
FT                   /product="polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40511"
FT                   /db_xref="GOA:B9DSY8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSY8"
FT                   /protein_id="CAR40511.1"
FT                   /translation="MPSYWSQYPEIEKEIKAVTQLIENRVQVRNTEIEKAIIQLSQAGG
FT                   KYLRPAFFFLFSSFGPYQKERKEQLQKIAASLEILHMATLVHDDVIDDSPLRRGNPTIQ
FT                   TQYGKDVAVYTGDFLFTVFFELILESMSNTPYMAINAKSMKKILVGELDQMHLYFNQKQ
FT                   SIRDYLRAISGKTAELFKLASQEGAYFSGADETVVRLAGRIGYHIGMTFQILDDILDYT
FT                   ADQKAFNKPVLEDISNGVYSLPLLFALRENPFALKPLLDKKESISSQELKEVANLVIAN
FT                   KGVDQAKDLARKYTQKAIDDIEKLPKSKAKKQLLQLTNHLLKRNI"
FT   misc_feature    complement(107066..107848)
FT                   /locus_tag="SUB0108"
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase, score
FT                   1.1e-50"
FT                   /inference="protein motif:HMMPfam:PF00348"
FT   misc_feature    complement(107282..107320)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:Prosite:PS00444"
FT   misc_feature    complement(107645..107689)
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:Prosite:PS00723"
FT   CDS             108150..109001
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SUB0109"
FT                   /product="4-diphosphocytidyl-2-c-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40512"
FT                   /db_xref="GOA:B9DSY9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSY9"
FT                   /protein_id="CAR40512.1"
FT                   /translation="MVSIIERAPAKINLGLDVLGKREDGYHDLEMVMISIDLCDYVTVS
FT                   PLKDDVIMIESDCPKMPINEKNDVYKVAKLIKSRYAISEGVSILLNKKIPVCAGMGGGS
FT                   SDAAATIRALNQLWDLKLSMEEMIAIGIAIGSDVPYCIQAGCAKIGGKGDRIELIDGKL
FT                   SSWVVLVKPDFGISTRTVFPEIDCDVISRVDISAIVNALEGNNYSDLITHMGNALEDIS
FT                   IARKPFIQKVKDKMVAAGADVALMTGSGPTVFALCQTEKQANRVFNSVKGFCKEVYKVR
FT                   TL"
FT   misc_feature    108402..108932
FT                   /gene="ispE"
FT                   /locus_tag="SUB0109"
FT                   /note="HMMPfam hit to PF00288, GHMP kinases putative
FT                   ATP-binding protei, score 4.3e-28"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   CDS             109062..109505
FT                   /transl_table=11
FT                   /locus_tag="SUB0110"
FT                   /product="MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40515"
FT                   /db_xref="GOA:B9DSZ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ0"
FT                   /protein_id="CAR40515.1"
FT                   /translation="MEKLESKIDQLVNQILLKAENQHELLFGACQSHVKLTNTQEHILM
FT                   LLSQEQLTNTDLAKKLNISQAAVTKAIKSLMKHEMLSAIKDTVDARVTYFELTPAAKPI
FT                   AEEHTQHHDETLNVYTKLLSSFSSEEKAVIDKFLTVFSDELER"
FT   misc_feature    109167..109484
FT                   /locus_tag="SUB0110"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.2e-16"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    109215..109280
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2043.000, SD 6.15 at aa 52-73, sequence
FT                   LTNTDLAKKLNISQAAVTKAIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             109510..110211
FT                   /transl_table=11
FT                   /locus_tag="SUB0111"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40517"
FT                   /db_xref="GOA:B9DSZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ1"
FT                   /protein_id="CAR40517.1"
FT                   /translation="MRYLTVENLAFQYESDPVLEGINYHLDSGEFVTLTGENGAAKSTL
FT                   IKATLGILKPKVGKVTFAKENTEGKKLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRN
FT                   GWFRRITKHDEEHIKVSLESVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYKLMNHSAHEHGKAVLMITHDPEEVKDYADRNIHLVRNQELPWRCF
FT                   NVHSKQDKEEN"
FT   misc_feature    109594..110154
FT                   /locus_tag="SUB0111"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-41"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    109921..109965
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             110211..111026
FT                   /transl_table=11
FT                   /locus_tag="SUB0112"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40519"
FT                   /db_xref="GOA:B9DSZ2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ2"
FT                   /protein_id="CAR40519.1"
FT                   /translation="MLDILSYDFMQRALLAMVAISLFAPILGIFLILRRQSLMSDTLSH
FT                   VSLAGVALGVVIGINPTWTTMLVVAIAAVVLEYLRVVYKHYMEISTAILMSMGLAVSLM
FT                   IMSQSSGASNVSLDQYLFGSIITISKEQVIALFVIAVTILLLTLFFIRPMYILTFDEDT
FT                   AFVDGLPVRLMSVLFNVVTGIAIALTIPAAGALLVSTIMVLPASIAMRLGKNFISVIVI
FT                   GILIGFVGMISGVFMSYNWGTPASATITIIFISIFLLVNIGSLIKQKWS"
FT   misc_feature    110226..111002
FT                   /locus_tag="SUB0112"
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family,
FT                   score 4.5e-93"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    order(110253..110309,110370..110438,110481..110549,
FT                   110610..110678,110736..110804,110853..110921,
FT                   110949..111008)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SUB0112 by TMHMM2.0 at aa 15-33, 54-76, 91-113, 134-156,
FT                   176-198, 215-237 and 247-266"
FT   CDS             complement(111086..112342)
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SUB0113"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40521"
FT                   /db_xref="GOA:B9DSZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSZ3"
FT                   /protein_id="CAR40521.1"
FT                   /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSGKIKGQ
FT                   LSQFLDFENGANKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNQKFNVTLQIGGSDQWGNMTAGTELLRRKADKTGHVMTVPLI
FT                   TDANGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDEDAIRFLKIFTFLSLEEIAEIE
FT                   KAFDAARHERLAQKTLAKEVVTLVHGEEAFKQALNITEQLFAGNIKNLSAAELKQGLSN
FT                   VPNYQVQDEDNLNIVEILVSSSISPSKRQAREDVQNGAIYLNGERIQDLDYTLTEDDKI
FT                   DGQLTVIRRGKKKYAVLTY"
FT   misc_feature    complement(111146..111289)
FT                   /gene="tyrS"
FT                   /locus_tag="SUB0113"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 6e-09"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    complement(111374..112267)
FT                   /gene="tyrS"
FT                   /locus_tag="SUB0113"
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 3.8e-107"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    complement(112196..112228)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             112434..114752
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SUB0114"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40523"
FT                   /db_xref="GOA:B9DSZ4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ4"
FT                   /protein_id="CAR40523.1"
FT                   /translation="MRYSILKDKHKNQHENSNGPKWNLWDFGAVFLRTVKLLSNFFYII
FT                   VFLFGMLGIGIAFGYLASQIDSVKVPSKDSLVKQVKTITMVSKINFSNNNLISDIDTDL
FT                   LRTPVANDAISDNVKKAIVSTEDENFNQHKGVVPKAVFRATLTAVLGLGESSGGSTLTQ
FT                   QLIKQQVLGDDPTFKRKSKEIIYALALERYISKDDILSDYLNVSPFGRNNKGQNIAGIE
FT                   EAARGIFGVSAKDLTIPQAAFLAGLPQSPIAYSPYLSTGQLKSEKEMELGIKRQHSVLY
FT                   NMFRAGMLSQKDYETYKAYPISKDFIAPENVTVNKHDYLYYSVMADAKKAMFDYLVKRD
FT                   NISERDLKNDATKASYEAMATTELQQGGYTVKTTINQKIYEAMQDAANRFGGLLDDGTG
FT                   MVQMGNVLTDNATGAVLGFIGGRDYNLNQNNHAFDTVRSPGSSIKPIIAYGPAIDQGLM
FT                   GSASVLSNYPTTYSSGQKIMHVDSEGTAMMSLQEALNTSWNIPAFWTEKLLREKGIDVE
FT                   AYMTKMGYVINDYSIESLPLGGGIDVSVGTQTNAYQMIANNGNYLEQYLVDSITASDGT
FT                   VVYKHEKKPVRVFSAPTATILQDLLRGPINSGSTTTFKSRLKAINPSLANADWIGKTGT
FT                   TENYSDVWLMLATPKVTLGGWAGHDNNDSLAPMTGYNNESNYMANLANAIQQAGGDVFG
FT                   VGQKFTLDPGVIKSTVLKSTGLQQGAVTVNGRKITVGGETTTSLWAKNGAGPMTYKFAI
FT                   GGTDSDYQKAWSSFGGGKK"
FT   misc_feature    112554..112622
FT                   /note="1 probable transmembrane helix predicted for SUB0114
FT                   by TMHMM2.0 at aa 41-63"
FT   misc_feature    112692..113213
FT                   /gene="pbp1B"
FT                   /locus_tag="SUB0114"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   1.3e-78"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    113640..114494
FT                   /gene="pbp1B"
FT                   /locus_tag="SUB0114"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 6e-13"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   CDS             115016..118582
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40524"
FT                   /db_xref="GOA:B9DSZ5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSZ5"
FT                   /protein_id="CAR40524.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRINEVLDLPNLIEIQTDSFQDFLDTGL
FT                   REVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDAKDIAYTRIDRTRKIPFTTLVRALGFSGDDEILDIFGDSELVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKIN
FT                   KKLNVKTRLLNQIIAENLVDSETGEILVEAGTEMTRDVIESIEAHIDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVQSPLDPDKVVTIVGNATPDDKVRALTPADILAEMSYFLNLSEGI
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGVVTNEIVWLTADEEDEF
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFAASTVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPFVGTGMEYQAAHDSGAAVIAQHDGKVVFSDAEKV
FT                   EVRREDGSLDVYHVTKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMEKGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREVPNV
FT                   GEEALRDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GATAEDLWDTVAEAGMDSDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDVMHVDD
FT                   LEKAREKQAQETPEVSENSEEK"
FT   misc_feature    115097..116422
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /note="HMMPfam hit to PF04563, RNA polymerase beta subunit,
FT                   score 9.4e-16"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    115433..115999
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain,
FT                   score 6.3e-13"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    116423..116641
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /note="HMMPfam hit to PF04565, RNA polymerase Rpb2, domain,
FT                   score 7.3e-41"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    117044..118210
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /note="HMMPfam hit to PF00562, RNA polymerase Rpb2, domain,
FT                   score 2.1e-243"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    117767..117805
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    118214..118444
FT                   /gene="rpoB"
FT                   /locus_tag="SUB0115"
FT                   /note="HMMPfam hit to PF04560, RNA polymerase Rpb2, domain,
FT                   score 3.5e-49"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS             118674..122312
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40526"
FT                   /db_xref="GOA:B9DSZ6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DSZ6"
FT                   /protein_id="CAR40526.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPMDTPLEPKSLLTEREYREKVQEYG
FT                   YGSFIAKMGAEAIQDLLKRVDLPAEIAELKEELKTATGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDIDEAVMAYQNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNAIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEAGQDIQEVIDNLPINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEAAHHRVEDINKAFRRGLMT
FT                   EDDRYIAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLVIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLISE
FT                   DMARKIVEAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGKVVDIEEDAST
FT                   RTKKVYVEGKTGNGEYVVPFTARMKVEIGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   EIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAINEVEIIEETEQAEETVVTEAE"
FT   misc_feature    118683..119669
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /note="HMMPfam hit to PF04997, RNA polymerase Rpb1, domain,
FT                   score 4.7e-144"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    119673..120101
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /note="HMMPfam hit to PF00623, RNA polymerase Rpb1, domain,
FT                   score 1.5e-83"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    120108..120665
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /note="HMMPfam hit to PF04983, RNA polymerase Rpb1, domain,
FT                   score 5.5e-69"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    120738..120980
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /note="HMMPfam hit to PF05000, RNA polymerase Rpb1, domain,
FT                   score 2.6e-25"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    120984..122090
FT                   /gene="rpoC"
FT                   /locus_tag="SUB0116"
FT                   /note="HMMPfam hit to PF04998, RNA polymerase Rpb1, domain,
FT                   score 2.1e-68"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS             122367..122798
FT                   /transl_table=11
FT                   /locus_tag="SUB0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40527"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ7"
FT                   /protein_id="CAR40527.1"
FT                   /translation="MSRYFSKRFLFVYNKHKKRMDNMYQVIKMYGDWEPWWFIEGWQND
FT                   IVDEKEFDQWDEALAFYKQEWQHMKDDFPSYHSQKNLLATFWRTTDKRWCEDCGDDLQQ
FT                   FHSILLLKDRDIIPSDQYVIAFEQRNDTPAAPYMCKLNF"
FT   misc_feature    122433..122795
FT                   /locus_tag="SUB0117"
FT                   /note="HMMPfam hit to PF06279, Protein of unknown function
FT                   (DUF1033), score 1.7e-73"
FT                   /inference="protein motif:HMMPfam:PF06279"
FT   CDS             122871..123812
FT                   /transl_table=11
FT                   /locus_tag="SUB0118"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40528"
FT                   /db_xref="GOA:B9DSZ8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ8"
FT                   /protein_id="CAR40528.1"
FT                   /translation="MIQSLGMQLIQEASLKQAQDIYLIPQKDSYQVFMRVGDSRQKIGD
FT                   YEWKDATNLISHFKFVAGMNVGEKRRTQLGSCDYHIDQQGLVSLRLSTVGDYRGHESLV
FT                   IRLLATQESQLHYWFDSFERIEKAIHGRGLYLFAGPVGSGKTRLMYALMEKYMQDSQII
FT                   TIEDPVEIKQDAILQLQVNNSIGMTYDNLIKLSLRHRPDLVIIGEIRDTETAQAVIRAS
FT                   LTGAMVFSTIHAKSIPGVFSRLIELGVKRDELLNCLNLIAYQRLIAGGGLIDFATEKFE
FT                   EHTHNQWNQEVEQLLKQGYIDNEKAKLEKIKG"
FT   misc_feature    122871..123680
FT                   /locus_tag="SUB0118"
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 2.3e-36"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    123285..123308
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    123459..123503
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS             123688..124779
FT                   /transl_table=11
FT                   /locus_tag="SUB0119"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40529"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B9DSZ9"
FT                   /protein_id="CAR40529.1"
FT                   /translation="MILPQKNSKSIPIINGIKRLSNFLNKDISITKKPSWKKLKAKQQY
FT                   QLIKLLHNLSLSGFNLNEMVSFLEKAHLLENHFVQRMKIDLMNGRDISEMMAHLGFSDA
FT                   LVTQLSLAEVHGNTTNCLAKIEDYMAQSNRIRQKTIEVITYPMVLMTFLIVILMGLRHY
FT                   LLPQIEEENQLTHFLNLFPTVLLLTFFAMIAVVIFLRLCWRKKSQLKQLLVYSKIPLLS
FT                   AVLQLYLTAYYAREWGNLIAQGVELATILQLMQKEKSVLMREMGSTMEKALLEGKSFDQ
FT                   SVGIFPFFKRELSLMIEYGEIKGKLGQELDIYAQVSWENYFRKLRQMTQWLQPLIFILV
FT                   AIIIVMIYAAMLLPMYQTIGGEI"
FT   misc_feature    123826..124185
FT                   /locus_tag="SUB0119"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    order(124114..124182,124225..124293,124678..124746)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0119 by TMHMM2.0 at aa 143-165, 180-202 and 331-353"
FT   misc_feature    124384..124749
FT                   /locus_tag="SUB0119"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 1.8e-17"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS             124780..125103
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SUB0120"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40531"
FT                   /db_xref="GOA:B9DT00"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT00"
FT                   /protein_id="CAR40531.1"
FT                   /translation="MKKWMKTLENKKAKAFTLLEMLMVLLIISVLMLLFIPNLSKQKEK
FT                   VTDKGNAAVVKIVENQAELYELNEGKKPNLSELVQNGNITKKQVEAYNDYYQKHPGENK
FT                   LLP"
FT   misc_feature    124819..124890
FT                   /gene="comYC"
FT                   /locus_tag="SUB0120"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 9.4e-06"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    124822..124890
FT                   /note="1 probable transmembrane helix predicted for SUB0120
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS             125057..125494
FT                   /transl_table=11
FT                   /locus_tag="SUB0121"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40533"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT01"
FT                   /protein_id="CAR40533.1"
FT                   /translation="MTIIKNILVKISCCHSKAFTLAESLLCLAVTTFTILLLSSSLAGV
FT                   YESVERELFFISFEHFYRHCQKMSVLKQEESALHFTAHRIKYGQRELVIPDHIRLLNQG
FT                   TIPFNKTGGSHSLAKIEWQTPREKLTYQLNLGSGNYQKRRH"
FT   misc_feature    125126..125194
FT                   /note="1 probable transmembrane helix predicted for SUB0121
FT                   by TMHMM2.0 at aa 24-46"
FT   CDS             125466..125765
FT                   /transl_table=11
FT                   /locus_tag="SUB0122"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40536"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT02"
FT                   /protein_id="CAR40536.1"
FT                   /translation="MEIIKNEDIKAYILLESLIALAIMVFIVSLLLSALKQSQKDIALM
FT                   RHKEEVVATGLMAIQTKQRQLELNGCHVTINSDQGGLSILENDQEILKISRLSN"
FT   misc_feature    125502..125570
FT                   /note="1 probable transmembrane helix predicted for SUB0122
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS             125725..126180
FT                   /transl_table=11
FT                   /locus_tag="SUB0123"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40538"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT03"
FT                   /protein_id="CAR40538.1"
FT                   /translation="MIKKYSKLVACPTKAFTLLEALVALLVISGSLLLYQGLTKSIFSQ
FT                   MTYLRENNQDRWLLFSHQLRAELMGSRFQKVEKNKIYVTKDGKDVAYGLSKRDDFRKTS
FT                   ANGHGYHPMLLHLSQATIEEKERTVTIHFVWKDGLERTWLYDFKENR"
FT   misc_feature    125767..125835
FT                   /note="1 probable transmembrane helix predicted for SUB0123
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS             126158..126517
FT                   /transl_table=11
FT                   /locus_tag="SUB0124"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40539"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT04"
FT                   /protein_id="CAR40539.1"
FT                   /translation="MILKKTVKGGILLYAILMTSIFLLLVQVYLKQMEAYKSEFRAQRL
FT                   HAQAHMMAEWVHSYAEKDKDAVAFREGDAQYQKKDQMLEVIISLKDGQKYRFNYPLADD
FT                   KKAQERNDETKEKAS"
FT   misc_feature    126176..126244
FT                   /note="1 probable transmembrane helix predicted for SUB0124
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS             126562..127518
FT                   /transl_table=11
FT                   /locus_tag="SUB0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40540"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT05"
FT                   /protein_id="CAR40540.1"
FT                   /translation="MNFEKIEKAYELILENAQLIENDLKTHIYDALIEQNSFYLGSPGA
FT                   SDHVAKNNEALAALSLSKEEWRRAFQFVFIKAGQTEQLQANHQFTPDSIAFILLFLLEE
FT                   LSSNDTLDILEIGSGTGNLAQTLLNNSKKSLDYLGIELDDLLIDLSASIAEIIGSSARF
FT                   IQEDAVRPQILKESDVIISDLPVGYYPNDDIARRYQVASPKEHTYAHHLLMEQSLKYLK
FT                   QGGYALFLVPSNLLTSQQSDLLKKWLTDYAQVMALVTLPETLFGHPSNAKSILVLQKKA
FT                   EKVGETFVYPLTDLQNPEIIRHFMTEFKKWKQDNVFS"
FT   CDS             127574..128764
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SUB0126"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40541"
FT                   /db_xref="GOA:B9DT06"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DT06"
FT                   /protein_id="CAR40541.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEETVLAQGIIERIGLKDSISTVK
FT                   FNGNKEEQVTDIPDHTTAVKILLNDLIHLNIISAYDEITGVGHRIVAGGEYFTDSVLVD
FT                   EKVIEQVEELSALAPLHNPGAAAGIRAFREILPDITSVCVFDNAFHMTMQKHTYLYPIP
FT                   QKYYTEHKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGQSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYIIERDPELKDAADAINMLNKKSGLGGVSGIS
FT                   SDMRDIEAGLQEKNPDAVLAYNIFIDRIKKFIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVINGMSWFGMEIDPEKNVFGYRGDISTPNSKVKVLVISTDEELCIARDVERLKK"
FT   misc_feature    127580..128740
FT                   /gene="ackA"
FT                   /locus_tag="SUB0126"
FT                   /note="HMMPfam hit to PF00871, Acetokinase family, score
FT                   9.7e-194"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    128177..128230
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS             128882..129085
FT                   /transl_table=11
FT                   /locus_tag="SUB0127"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40543"
FT                   /db_xref="GOA:B9DT07"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT07"
FT                   /protein_id="CAR40543.1"
FT                   /translation="MDNRIQELRKEHKISQAELAEAMEVTRQTIISLEKGRYNASLELA
FT                   FKLATYFNLSIEDIFIYKESGY"
FT   misc_feature    128894..129058
FT                   /locus_tag="SUB0127"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    128921..128986
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1921.000, SD 5.73 at aa 14-35, sequence
FT                   ISQAELAEAMEVTRQTIISLEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             129087..129539
FT                   /transl_table=11
FT                   /locus_tag="SUB0128"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40546"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT08"
FT                   /protein_id="CAR40546.1"
FT                   /translation="MFVRFFQELNKPKSEQDFIKRYRFWSRFLLILAILMVALNFHLDL
FT                   PSYSKGFLIGMSIALLALALRNLVNLKRPAYLHGLYIKSRDERNTQIAQISSTITMFIQ
FT                   ILLVALCLILNAFWQIDFNFRLFLIADLYIMLISLFGLTFLLEKYM"
FT   misc_feature    order(129156..129212,129240..129299,129360..129428,
FT                   129456..129524)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0128 by TMHMM2.0 at aa 24-42, 52-71, 92-114 and 124-146"
FT   CDS             129548..130201
FT                   /transl_table=11
FT                   /locus_tag="SUB0129"
FT                   /product="CAAX amino terminal protease family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40547"
FT                   /db_xref="GOA:B9DT09"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT09"
FT                   /protein_id="CAR40547.1"
FT                   /translation="METVLTKLKWLFMAIGILVVEQAPMLFMKKGQPLWQVIALTGVML
FT                   LVVLASLWIAQKLGFFAKDQEKAHDNAILWIGLGFVALTAVKLFGGILLYLQHGADANT
FT                   VNQAALEKAGLHPILLFTLAAIVAPVVEELIFRGLLFGKLFGHKSIIGLLFSSFLFGLI
FT                   HMPSDFGSWFIYGGMGLVLGFVYYKTDKLHYTMWIHFLNNGIAVVLMLIMQQMT"
FT   misc_feature    order(129575..129628,129647..129715,129758..129826,
FT                   129887..129955,129965..130033,130052..130105,
FT                   130133..130186)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SUB0129 by TMHMM2.0 at aa 10-27, 34-56, 71-93, 114-136,
FT                   140-162, 169-186 and 196-213"
FT   misc_feature    129902..130177
FT                   /locus_tag="SUB0129"
FT                   /note="HMMPfam hit to PF02517, CAAX amino terminal protease
FT                   family, score 1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS             complement(130227..130997)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SUB0130"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40548"
FT                   /db_xref="GOA:B9DT10"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT10"
FT                   /protein_id="CAR40548.1"
FT                   /translation="MKIGFIGVGKMATAIIQGLKTTSHDIIISGSSLERSKEIGQKLEV
FT                   DYAQNHQELIDQSDFVILGIKPQLYETVLAPLSFKQPVMSMAAGVTIARLEELIGSHVP
FT                   LFRIMPNMNAQILKSTTALTHNDLVDPALLQAVREMVESFGSCFNITEKDFDTFTALAG
FT                   SSPAYIFLFIEAMAKAGVKHGIAKETALEIVSQTVQASALQLLQGQDSPHTLIDKICSP
FT                   GGTTIAGLMELERTGLTHAVSSAIDKTIEKAKTL"
FT   misc_feature    complement(130275..130997)
FT                   /gene="proC"
FT                   /locus_tag="SUB0130"
FT                   /note="HMMPfam hit to PF01089, Delta
FT                   1-pyrroline-5-carboxylate reductase, score 3.5e-70"
FT                   /inference="protein motif:HMMPfam:PF01089"
FT   misc_feature    complement(130296..130364)
FT                   /note="PS00521 Delta 1-pyrroline-5-carboxylate reductase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00521"
FT   CDS             complement(131019..132083)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SUB0131"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40550"
FT                   /db_xref="GOA:B9DT11"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT11"
FT                   /protein_id="CAR40550.1"
FT                   /translation="MSELFSKIKEVTELDGIAGYEHTVRDYLRQKISPLVDRVETDGLG
FT                   GIFGIKDSQAEDAPRIMVAAHMDEVGFMLSHINPNGSFSVVGIGGWNPLVVSSQRFTLY
FT                   TRAGKAIPVVSGSVPPHFLRGGAGQQLPKVEDILFDGGFADKAEAEAFGIAPGDIIVPQ
FT                   SETILTANQKNIISKAWDNRYGLLMVTELLEHLKGQSLNNTLIAGANVQEEVGLRGAHV
FT                   STTKFDPELFFAVDCSPAGDIYGNQGAIGQGTLIRFYDPGHIMLKDMRDFLLTTAEEAG
FT                   IKYQYYCAKGGTDAGAAHLKNHGIPSTTIGVCARYIHSHQSLYAMDDFLQAQAFLQAIV
FT                   KKLDRSTVDLIKKY"
FT   misc_feature    complement(131079..131951)
FT                   /gene="pepA"
FT                   /locus_tag="SUB0131"
FT                   /note="HMMPfam hit to PF05343, M42 glutamyl aminopeptidase,
FT                   score 5.2e-141"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   misc_feature    complement(131997..132083)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             132223..132519
FT                   /transl_table=11
FT                   /locus_tag="SUB0132"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40552"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT12"
FT                   /protein_id="CAR40552.1"
FT                   /translation="MKSMNKKTKMTWTGLIGIPTAAVLALLLKEKYQDYQQEKMTADIR
FT                   QFFSQKGDIELVYFDVPQPQSKERNGGLVMSDGRQYSFTYQKGAIIYQEEKND"
FT   misc_feature    132250..132306
FT                   /note="1 probable transmembrane helix predicted for SUB0132
FT                   by TMHMM2.0 at aa 10-28"
FT   CDS             132512..132826
FT                   /transl_table=11
FT                   /locus_tag="SUB0133"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40553"
FT                   /db_xref="GOA:B9DT13"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT13"
FT                   /protein_id="CAR40553.1"
FT                   /translation="MIEPKSYEELAQIIEKPEKIVLFFTADWCPDCQFIYPVMPEIEAE
FT                   NADFTFIRVNRDNFMEVAQEWNIFGIPSFVVLENGKEIGRLVNKLRKTKAEINDFLARL
FT                   "
FT   misc_feature    132512..132796
FT                   /locus_tag="SUB0133"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 7.7e-06"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS             132845..133471
FT                   /transl_table=11
FT                   /locus_tag="SUB0134"
FT                   /product="putative tRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40554"
FT                   /db_xref="GOA:B9DT14"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT14"
FT                   /protein_id="CAR40554.1"
FT                   /translation="MIFAYNKEQVGDVLMVILEDSKAIKRQVERHGKVARVFAEEGGRT
FT                   LAWNIFEASTLIPIQGKGQVFPSSEDVAVLNKELAKEGFTEELEVSPNPVFVVGQIMEM
FT                   VAHPDSDHLNICQVQVAADQKVQIVAGAPNAKVGLKTIVALPGAMMPNGSLIFPGKLRG
FT                   EDSFGMMCSPRELALPNAPQKRGIIELDESAIVGQAFDADKHWQG"
FT   misc_feature    133130..133441
FT                   /locus_tag="SUB0134"
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS             133665..137474
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="SUB0135"
FT                   /product="putative fructan beta-fructosidase precursor"
FT                   /EC_number="3.2.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40555"
FT                   /db_xref="GOA:B9DT15"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT15"
FT                   /protein_id="CAR40555.1"
FT                   /translation="MKQEKKCVNWFMRKRGKQWIYGCGILICGLVFGVEATSVAAETIP
FT                   TTATVETLNSDVTSKTSQETQKTTEIATPVSEIVMPSQQKVVEEVTQEVSVQNQETVIN
FT                   MPVLTQGVNIAGPNETAILTDSIVQNNVQPIDRVEKMETSFSTELTKKAESSYNTNLQD
FT                   LNYDPNVWEVREDGLYSNAVGKGDNFLFSASTGENFIFQTDVTFLQNTGAASLVFRSNN
FT                   DPENLNGYVVNLDGNSHKARLWRWAEANLINDKEILASPDNKYFLKVVATNGWISYYIN
FT                   GILIANLSDYTIQRDDLGQTTYIKDGHFGLLNWNGEMVFQNTFYRELTNEELPLLNDVT
FT                   VTSKNGPVEPKGQFFSESSVYIQYVSNDASTVDLSFDANNSDALITVTDAHGKVYSNPS
FT                   AIPVTVGPNYLTVTSTYTTTDGYVIPSTYRINVHRRQPQSVYYNENFRDQYHYSVKDGW
FT                   ANDPNGLVYYNGVYHMFYQFYDDTKWGPMHWAHATSTDLIHWEDQPIAFYPDYNGTMFS
FT                   GCIVADVNNSSGLFDSENGGLVALITINGEGQRIKLAYSTDEGKTWQKVDEIVADWTTD
FT                   PLQTRDFRDPKVFRWENKWFMVIAGGPLRLYSSDDLKNWTVESTYPDLHTECPDLYPVL
FT                   AEDQTVKWVLSRGGRYYKVGDLQQADGNWKFIPDANYQETDSIMNFGKDSYAAMTYYVQ
FT                   DFGTKANPTIPKIIELNWMNTWDNYCNLVADRLGQSFNGTFNLNLELGLVKEGDKYVLT
FT                   QTPVEAYESLRDNDNKVEYKNVVVGKENDLFKDFSGDTYEIVAHFKPSDKTTKVGFNLR
FT                   VGSGEMTKVYYDLIAGRIIIDRSQSGIILTELFSNIDSQAVTPNIDGSIDLHIFVDRAS
FT                   VEVFSKNHTVAGANQIFTSAQSLGLEVLIDGEDAKADIVLYPLKSIWKNKIIDTTPQIV
FT                   IPASEPKVRMNVGDSTTVKAYVSPVGASQDLIWNISNPSLVLDQISGNQVFLKAIKKGQ
FT                   VIVRAQSQSNPAVYQDFIIDILEDNFNTNVKDVNVFSGDWYVDGESLKVANHNSNDIYM
FT                   SADKIPYENYQMDLDIKYGRGIVNIFFASGNPDANNAYTIQFGSNNSVRLFRFYRDTIF
FT                   EAPMIDVINDNQFHHVRLVKSANVIHVYVDNEMVMSYTFDQVEEFFNNPYLGLGLWDGE
FT                   LAVQNFYVIDLDAQKPVFVEEHEKEKLLSELKKSVVKTSSYSTLKTIETSSKTNSENLE
FT                   APTVSKKNLPMTSDSNNNLEELGILVILTTLGAFLGRVILKKEK"
FT   sig_peptide     133665..133787
FT                   /gene="fruA"
FT                   /locus_tag="SUB0135"
FT                   /note="Signal peptide predicted for SUB0135 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.908 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    133719..133787
FT                   /note="1 probable transmembrane helix predicted for SUB0135
FT                   by TMHMM2.0 at aa 19-41"
FT   misc_feature    135015..136313
FT                   /gene="fruA"
FT                   /locus_tag="SUB0135"
FT                   /note="HMMPfam hit to PF00251, Glycosyl hydrolases family,
FT                   score 3.6e-36"
FT                   /inference="protein motif:HMMPfam:PF00251"
FT   CDS             137638..138036
FT                   /transl_table=11
FT                   /locus_tag="SUB0136"
FT                   /product="putative single stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40561"
FT                   /db_xref="GOA:B9DT16"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT16"
FT                   /protein_id="CAR40561.1"
FT                   /translation="MYNKVILIGRLVANPELITTPKNKQVCRVSVAVNRRYKNAEGERQ
FT                   VDFINLVLWGKLAESLASYGSKGSLISIDGELRTRKYEKDGKTSYMTEVLGHFYQLLES
FT                   RAQRAMRENNMTDDLTDLVLDEEEELPF"
FT   misc_feature    137641..137946
FT                   /locus_tag="SUB0136"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 1.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS             138527..139486
FT                   /transl_table=11
FT                   /locus_tag="SUB0137"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to SUB0138, 52.412% identity (53.094%
FT                   ungapped) in 311 aa overlap (7-313:6-316)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40562"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT17"
FT                   /protein_id="CAR40562.1"
FT                   /translation="MKKGMRFSLILLALMLLTACRQVSDKSGQSVKVGIVQYAEHPALD
FT                   AARQGFMQALADGGYKEGKNLKLTKKNAQGDQSNLQTMVEQLAGKNDLHFAIATPAAQA
FT                   LLNADPDTPTVFTAVTDPVSAKLVKSLAKPGGNITGTLDATDVKQQIDLLTKVVPQAKT
FT                   IGIFYNSSEVNSQTQAKMAEKAIKKKGLKAVVKTVTSSNDVQQVMTSLAGQVDAIYLPT
FT                   DNTVASTATTIGQIVKEAKVPTMGSDDAYLDSLLLTSGVNYKEIGKEAGKKALLILKGK
FT                   KPSEIPVGKPRKPLVKINPDMAKALGLDVKTLETIVGQ"
FT   sig_peptide     138527..138616
FT                   /locus_tag="SUB0137"
FT                   /note="Signal peptide predicted for SUB0137 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.867 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    138554..138586
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    138620..139474
FT                   /locus_tag="SUB0137"
FT                   /note="HMMPfam hit to PF04392, Protein of unknown function
FT                   (DUF534), score 6.6e-83"
FT                   /inference="protein motif:HMMPfam:PF04392"
FT   CDS             139503..140465
FT                   /transl_table=11
FT                   /locus_tag="SUB0138"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to SUB0137, 52.412% identity (53.094%
FT                   ungapped) in 311 aa overlap (6-316:7-313)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40564"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT18"
FT                   /protein_id="CAR40564.1"
FT                   /translation="MKLKTYLLLGLTSLLLVGCRNAESSPTKTSGKVTVGILQYMEHDS
FT                   LTAARKGFETALKEGGYEAGKNLTIDYQNAQGDQSNLQTMSEQLVKKSDVVLAIATPSA
FT                   QSLATVSTETPVLFTAVTDPLSANLVKSIKKPGGLITGTSDQAPIDKQVDLLKQALPQA
FT                   KKVGILYTSSERNSEVQVKEAEKELKKAGYEIVKKGISSSNDVQDAATSLMKTSDALFV
FT                   PTDNTVASTMTMLGQLSLDNKVPVIGGSTDMVDAGGLLTYGTNYTELGKQVGKQALKVL
FT                   KGQKLATIPVEYPKKLELHVNQKQAEALGIDVSHLSLKN"
FT   sig_peptide     139503..139568
FT                   /locus_tag="SUB0138"
FT                   /note="Signal peptide predicted for SUB0138 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.635 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    139527..139559
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    139602..140459
FT                   /locus_tag="SUB0138"
FT                   /note="HMMPfam hit to PF04392, Protein of unknown function
FT                   (DUF534), score 1.2e-90"
FT                   /inference="protein motif:HMMPfam:PF04392"
FT   CDS             140502..141386
FT                   /transl_table=11
FT                   /locus_tag="SUB0139"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40566"
FT                   /db_xref="GOA:B9DT19"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT19"
FT                   /protein_id="CAR40566.1"
FT                   /translation="MALILSSISQGLLWSVMAIGVYLTFRILDIADLTAEGSYPLGAAI
FT                   CASSIVSGMNPLLATLLAFLGGLLAGLMSGFIHTKLKIPALLTGIISLTALYSINLKVL
FT                   GKANVALLGQKTLVSQLYDMGFTKTASVMIVGGIFVGLVIVLLTLLMKTQIGLALRSTG
FT                   DNIPMSEANGIQTDHMKLMGYMLSNGLIALCGALLCQNNGYADLNAGVGTIVIGLASII
FT                   IAEVVIRNLSIGWRLLSVVLGSVIYRLIILAILSIPGMDADLVKLFSAMLLAAVLYLPE
FT                   WQAKLKLGQAKLG"
FT   misc_feature    140508..141332
FT                   /locus_tag="SUB0139"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 1.7e-19"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    order(140535..140603,140661..140729,140748..140816,
FT                   140886..140954,141042..141098,141126..141185,
FT                   141204..141272)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SUB0139 by TMHMM2.0 at aa 12-34, 54-76, 83-105, 129-151,
FT                   181-199, 209-228 and 235-257"
FT   CDS             141395..142198
FT                   /transl_table=11
FT                   /locus_tag="SUB0140"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40568"
FT                   /db_xref="GOA:B9DT20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT20"
FT                   /protein_id="CAR40568.1"
FT                   /translation="MSSLLSIQNIHKVFEVGTVNENHVLRGLSLDVNEGDFISIIGGNG
FT                   AGKSTLMNCLAGTLSLNQGDILLEGQSITNQSAAKRAKAISRVFQDPKMGTASRLTIEE
FT                   NMAIAHRRGKKRGLSWGVKEDERLIYKEALKELGLNLENRLKVDTQFLSGGQRQALTLL
FT                   MASLEKPKVLLLDEHTAALDPKTSDMVMALTDKIVKTHGLTTLMITHNMENAIAYGNRL
FT                   VMLHQGRIVVDVKGQEKANLTVNQLMGLFQKNSGQNLSDDALVLG"
FT   misc_feature    141497..142078
FT                   /locus_tag="SUB0140"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-43"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    141518..141541
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    141848..141892
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             complement(142403..143044)
FT                   /transl_table=11
FT                   /locus_tag="SUB0141"
FT                   /product="putative deoxyadenosine kinase protein"
FT                   /EC_number="2.7.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40569"
FT                   /db_xref="GOA:B9DT21"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT21"
FT                   /protein_id="CAR40569.1"
FT                   /translation="MLIVLAGTIGAGKSSLAAALGEHLGTEVFYEAVDNNPVLDLYYQD
FT                   PKKYAFLLQIFFLNKRFKSIKEAYKADNNILDRSIFEDELFLTLNYKNGNVTKTELEIY
FT                   QELLGNMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSFEQVDDNPGLEDYYAQV
FT                   HGEYPDWYENYHVSPKMKIDGNQLDFVQNPDDLKTVLEMVDTKLKELDLL"
FT   misc_feature    complement(142430..142888)
FT                   /locus_tag="SUB0141"
FT                   /note="HMMPfam hit to PF01712, Deoxynucleoside kinase,
FT                   score 4.5e-49"
FT                   /inference="protein motif:HMMPfam:PF01712"
FT   misc_feature    complement(143003..143026)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(143063..144040)
FT                   /transl_table=11
FT                   /locus_tag="SUB0142"
FT                   /product="putative tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40571"
FT                   /db_xref="GOA:B9DT22"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT22"
FT                   /protein_id="CAR40571.1"
FT                   /translation="MTKLNSSFMIGNVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPDKIYHIVSEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHETLARVSKAITKIPFIGNGDVRTVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGEELPDLPFDKKLDIAEDHLRRLINLKGEN
FT                   IAVREFRGLAPHYLRGTAGAAKIRGAVSRAETLAEVESIFAQVR"
FT   misc_feature    complement(143066..143983)
FT                   /locus_tag="SUB0142"
FT                   /note="HMMPfam hit to PF01207, Dihydrouridine synthase
FT                   (Dus), score 2.6e-101"
FT                   /inference="protein motif:HMMPfam:PF01207"
FT   misc_feature    complement(143681..143737)
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01136"
FT   CDS             complement(144027..144899)
FT                   /transl_table=11
FT                   /locus_tag="SUB0143"
FT                   /product="33 kDa chaperonin (heat shock protein 33
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40573"
FT                   /db_xref="GOA:B9DT23"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DT23"
FT                   /protein_id="CAR40573.1"
FT                   /translation="MDKIIKSISETGSFRAFVLDSTQTVKTAQEKHQTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAVGLNVLLD
FT                   EEDKVKVAGGFMVQALPGASEEEIARYEKRLQEMPAISTLLAAEDPSDALLSAIYGDEG
FT                   YKRLSEDSLSFQCDCSKDRFESALMSLPNTDLQDMIDQDHGAEIICQFCQTRYQFSEDD
FT                   LKGIINDKA"
FT   misc_feature    complement(144063..144899)
FT                   /locus_tag="SUB0143"
FT                   /note="HMMPfam hit to PF01430, Hsp33 protein, score
FT                   2.4e-146"
FT                   /inference="protein motif:HMMPfam:PF01430"
FT   CDS             complement(145040..146539)
FT                   /transl_table=11
FT                   /locus_tag="SUB0144"
FT                   /product="putative Mga-like regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40575"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT24"
FT                   /protein_id="CAR40575.1"
FT                   /translation="MYIKQNLFSNQQLRGLKLAVLLNHGEEPCDYTHICRHLHCSFLTL
FT                   QTEIAHLASFGEVRALPYVEPHLEVQYRPEFGPQKLFQSILNETPSMRLVEALFYKDFD
FT                   SLEELAEALFTSLSTLKRLIKRTNVYLQLGFNCVINVRSVRIVGPEHSVRLLYLKYFTE
FT                   VYDNYAWPFLDSINEIALTSLVDMTASKFSHRVTHSLFAYLKIMSAVNLIRFSKGYRVN
FT                   EVYPRSCSLYEKLKEDPTFLHLSELFWRDFGKPLDQVALSEMFSTYFRQDLILNAELDR
FT                   QNTDKEVEGVTYEDMLETLEGIENRFGMPIANKSEISLLIYNALILKEHDIYENFLVYD
FT                   YREPYIAYFNDSYPKLLEAFQEALLAPFKAKGVELAKERQNHLLYILLVNWDNLFFHIS
FT                   RAIDKQKVLVVEKGTCNSGQFLIAYAGQYFDIAIHEHHQIDMHKIKEEYDVVLTDQTLE
FT                   VVDGVDIIYFSQLVPSIALEKLNKFLKKKIQKHFLEEPEEE"
FT   misc_feature    complement(145088..146524)
FT                   /locus_tag="SUB0144"
FT                   /note="HMMPfam hit to PF05043, M protein trans-acting
FT                   positive regulator (M, score 7.5e-99"
FT                   /inference="protein motif:HMMPfam:PF05043"
FT   misc_feature    complement(146165..146230)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1682.000, SD 4.92 at aa 104-125, sequence
FT                   DSLEELAEALFTSLSTLKRLIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             146844..148391
FT                   /transl_table=11
FT                   /gene="lbp"
FT                   /locus_tag="SUB0145"
FT                   /product="lactoferrin binding protein"
FT                   /note="Similar to Streptococcus uberis Lbp lactoferrin
FT                   binding protein UniProt:Q6U7J0 (561 aa) fasta scores:
FT                   E()=1.9e-52, 62.234% id in 564 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40577"
FT                   /db_xref="GOA:B9DT25"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT25"
FT                   /protein_id="CAR40577.1"
FT                   /translation="MRKFYYKEKKMEIKQKHGKHALRKAVTAAVLAGTAFSSLGGFAGA
FT                   VTTVKAEDLFTINNSEVQDKLESKVKQLLEAQRKGEDISEKLRELLSELPTDILKDIML
FT                   SNIEADYLLGFLKPAVEEMVRRSEQNDERWKDITEKTLALEALKDSEREIRKEKEKLED
FT                   EVQLAKVKIETKESELNDLKKDYIDTREELADTIEELDEVKNSIVEKEAKVKGLEEKLR
FT                   DLEKELGDYDKKLSEAAKQNSDLSNENKELKENLDTAENITVELQKKSHELEKTKKEVE
FT                   LELKAEKEALEAEKVKLAEANEANDKLSEERDAAKKEAEKVPELEGQVEKLVEEITAAK
FT                   KEAEELQAKAEGLEKDFEAVKAEKEALEAEIAKLKEDHQKEVDALNALLADKEKMLKSL
FT                   QEQLDKAKEEAMKNEQMSQEEKAKLQAELDKAKQELAEKIKDMPNKVAPQAEGKANAGQ
FT                   AAPNQNQNNQAQANQAKNANNLPSTGDKPVNPLLVASGLSLMIGAGAFVYAGKRKKG"
FT   sig_peptide     146844..146996
FT                   /gene="lbp"
FT                   /locus_tag="SUB0145"
FT                   /note="Signal peptide predicted for SUB0145 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.882 between residues 51 and 52"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(146916..146984,148305..148373)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0145 by TMHMM2.0 at aa 25-47 and 488-510"
FT   misc_feature    148257..148382
FT                   /gene="lbp"
FT                   /locus_tag="SUB0145"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   2.6e-07"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    148281..148298
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS             complement(148492..150753)
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="SUB0146"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40578"
FT                   /db_xref="GOA:B9DT26"
FT                   /db_xref="InterPro:IPR006335"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT26"
FT                   /protein_id="CAR40578.1"
FT                   /translation="MLNQLLQKLPQNTDILEATFGLEREGLRLTQEGTLAQTDHPKALG
FT                   SRSFHPYIQTDFSEQQLELITPISQSTQEARRRLGAIFDVAQRSLEEDQVIWPLSIPPY
FT                   IEEDQIQIAKLDKAEEVRYREQLAQTYGKKLQSISGIHYNIELGKNLTQNLFALSDQED
FT                   LKDFKNAIYMKLARQFLNYQWLVTYLFGASPLAEKDFYPQMPTELVRSLRASRRYGYSN
FT                   HEELSISFSSLENYVKDMENALATGILSLEKEFYSPVRLRGSKHSRDYLSEGITYLEFR
FT                   NFDINPFDKLGISQKTLDSFHLFLLSLLWLDDLKDSDQELTKARQINEEVALAHPMSPL
FT                   PDPELARPVLKAMTELIQHFGLDAYYQDLVADLELAIKEPERTISGHLFGKIANASLAA
FT                   FGLDQAKTYHQEATQAPYALKGYESMELSTQMLMFDAIQKGLHLDILDENDQFLKIWHG
FT                   DHVEYVKNGNMTSRDNYVVPLAMANKTVTKKILDQAGFPTPKGQEFASKDQAIRYFNQI
FT                   ADKAIVVKPKSTNFGLGISIFQKPASQADYEKAVEIAFAEDRDILVEEFIAGTEYRFFT
FT                   LNGKCEAVLLRLPANVVGDGIHTVKELIDLKNQNPLRGLDHRSPLEKIQLGDIEKLMLA
FT                   QEGYGPDSVLAKGVKVELRRNSNISTGGDSVDMTDEMDPSYKALAAQMADAMGAWVCGV
FT                   DLIIPDPSQKASLEEPNCHCIELNFNPSMYMHTYCQEGPGQAITPKILQALFPELPIYP
FT                   "
FT   misc_feature    complement(149758..150747)
FT                   /gene="gshA"
FT                   /locus_tag="SUB0146"
FT                   /note="HMMPfam hit to PF04262, Glutamate-cysteine ligase,
FT                   score 1.7e-94"
FT                   /inference="protein motif:HMMPfam:PF04262"
FT   CDS             complement(150950..151243)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0147"
FT                   /product="prophage maintenance system killer protein
FT                   (fragment)"
FT   misc_feature    complement(order(150959..151027,151046..151099))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0147 by TMHMM2.0 at aa 51-68 and 75-97"
FT   misc_feature    complement(150971..151243)
FT                   /locus_tag="SUB0147"
FT                   /note="HMMPfam hit to PF05012, Prophage maintenance system
FT                   killer protein, score 8.7e-05"
FT                   /inference="protein motif:HMMPfam:PF05012"
FT   CDS             complement(151234..151491)
FT                   /transl_table=11
FT                   /locus_tag="SUB0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="CDS is possibly truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40580"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT27"
FT                   /protein_id="CAR40580.1"
FT                   /translation="MQINLENLVPITEANQNFSKVARMVDSKGTAVILKNNKPKYVLLD
FT                   YATLINEEHKEVEITDKNTLDKVANAVLSKHLDAFKELEI"
FT   CDS             complement(151522..151653)
FT                   /transl_table=11
FT                   /locus_tag="SUB0149"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40582"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT28"
FT                   /protein_id="CAR40582.1"
FT                   /translation="MHSWQALVDGYKSNHFDTLNVLAFDYFLFIGYIHPIFLVIVYK"
FT   misc_feature    complement(151528..151596)
FT                   /note="1 probable transmembrane helix predicted for SUB0149
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS             complement(151684..152934)
FT                   /transl_table=11
FT                   /locus_tag="SUB0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40585"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT29"
FT                   /protein_id="CAR40585.1"
FT                   /translation="MSEFNFDIDQIANNAISKSDKTTEIITDQVDTSGKTISFYEKLSP
FT                   EQQSAISSKAPALVDSFMANQNTLLDFGQSAVEGVNATVNHILREQKKLEIPQVDDLLK
FT                   KTNQELNGFVAKYKDVGPADLEKKPNLLQKLFKQSKNTLQEFYFDAQNIEQKMDGMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIENLVGVIAFVEASLKEATQRAQALQTELKSLDA
FT                   VTPEYQSKTDLLARTTEVVNTLEQQHTEYVSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGILQQSVKSGATADAIVNANNAALQMLAETSKEAIPALERSAQ
FT                   NPTLSIQSVTALAESLVEQNNGIIAAIDDGRHKRAQLEHAIIQSAETINDSVKLRDEKI
FT                   VQALLDQGREQQKEVEK"
FT   misc_feature    complement(152203..152250)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS             complement(152943..153803)
FT                   /transl_table=11
FT                   /locus_tag="SUB0151"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40589"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT30"
FT                   /protein_id="CAR40589.1"
FT                   /translation="MNLKSFDKLIEHLPRIPGWIWLIVYFGCLGVISDVVHDGLFLIAA
FT                   IGLGMAFRYTGKRQKFLRGQKLAKRIQQLKDTVQIADKQSKLLNQYLIDKDTHNFQLVA
FT                   NQLLPKLDFIKEESYQLQGHIPSDVYKRINHKADQVRVDTVLQLEQVEIDSHMSQQFVI
FT                   DKIITEQAPEIQEIYQNVLRDNKTILEKIEAADDKAELTALQESSMDHFYDILNGYLKI
FT                   KSSPKDYYKAEERLASALQALKQFDLDLDETLRKLNESELKDFDVSLRMMQDKSKQNTI
FT                   APDLE"
FT   misc_feature    complement(order(153636..153689,153708..153761))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0151 by TMHMM2.0 at aa 15-32 and 39-56"
FT   CDS             154158..155450
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SUB0152"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40590"
FT                   /db_xref="GOA:B9DT31"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DT31"
FT                   /protein_id="CAR40590.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPEKISVIGNGVVVNPKSLVKELAYLHEEGITTDNLRISDRAHV
FT                   ILPYHIKLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKEIFAERLRIN
FT                   LAEKNRLFEKMYDSEALDFDSIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGDRIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGERIDYYPASLEQLKRCKPIYEELPGWSEDITGVRSLDDLPENARNYVRR
FT                   VSELVGVRISTFSVGPGREQTNILESVWANI"
FT   misc_feature    154164..155423
FT                   /gene="purA"
FT                   /locus_tag="SUB0152"
FT                   /note="HMMPfam hit to PF00709, Adenylosuccinate synthetase,
FT                   score 5.1e-283"
FT                   /inference="protein motif:HMMPfam:PF00709"
FT   misc_feature    154185..154208
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site."
FT                   /inference="protein motif:Prosite:PS01266"
FT   misc_feature    154548..154583
FT                   /note="PS00513 Adenylosuccinate synthetase active site."
FT                   /inference="protein motif:Prosite:PS00513"
FT   CDS             155574..155747
FT                   /transl_table=11
FT                   /locus_tag="SUB0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="Possible phage remnant. Similar to Bacteriophage
FT                   bIL310 Orf6 UniProt:Q9AZK3 (74 aa) fasta scores: E()=0.068,
FT                   41.071% id in 56 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40592"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT32"
FT                   /protein_id="CAR40592.1"
FT                   /translation="MKHLKDRFNIVDTDFGTQIIIDNETGVEYYKNGYQIIPLLEANGK
FT                   PKLNKDWLANQS"
FT   CDS             155829..156185
FT                   /transl_table=11
FT                   /locus_tag="SUB0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40593"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT33"
FT                   /protein_id="CAR40593.1"
FT                   /translation="MSHKVFQMAFASIYQALVAKVERKGGQAEDVDALISWLMGYSAER
FT                   LAALKSSQITYGDFIDQAPHFNPDRQNITGKICGVQIEAIEDDRMQKLRQLDKLVDWLA
FT                   KGKSPQEVIAKYSK"
FT   CDS             156412..157455
FT                   /transl_table=11
FT                   /locus_tag="SUB0155"
FT                   /product="basic membrane protein"
FT                   /note="Similar to Listeria monocytogenes CD4+ T
FT                   cell-stimulating antigen precursor TcsA UniProt:TCSA_LISMO
FT                   (EMBL:AL591979) (357 aa) fasta scores: E()=1.4e-53, 48.179%
FT                   id in 357 aa. Similar to SUB0950, 68.091% identity (68.876%
FT                   ungapped) in 351 aa overlap (1-347:1-351)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40594"
FT                   /db_xref="GOA:B9DT34"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT34"
FT                   /protein_id="CAR40594.1"
FT                   /translation="MNKKLTSLALLSAAIIPLAACSHKGQKSASLSDLKVAMITDQGGV
FT                   DDKSFNQSAWEGLQAWGKSKNLKKGSDFNYFQSTNESEYVTNLDTAKSNGFNVIFGIGF
FT                   NLTDSIKKASSDNADTKYAIVDDVIEGKDNVASITFADNEAAYLAGVAAAKTSKSKQVG
FT                   FVGGMEGTVVKRFEKGFEAGVKSVDPSIKVSIAYAGSFADAAKGKSIAATQYASGADVI
FT                   YQAAGGTGAGVFNEAKAINEKRAASDKVWVLGVDRDQKAEGEYTDKDGQKGNFVLASSI
FT                   KEVGKTMQKVIGMTEKGDFPGGKVNTFGLKESGVNLTTKDLPEDVKKAVETARQDIISG
FT                   KIKVPEK"
FT   sig_peptide     156412..156471
FT                   /locus_tag="SUB0155"
FT                   /note="Signal peptide predicted for SUB0155 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.394 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    156436..157452
FT                   /locus_tag="SUB0155"
FT                   /note="HMMPfam hit to PF02608, Basic membrane protein,
FT                   score 5.2e-87"
FT                   /inference="protein motif:HMMPfam:PF02608"
FT   misc_feature    156580..156603
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    157015..157038
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    157087..157107
FT                   /note="PS00227 Tubulin subunits alpha, beta, and gamma
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00227"
FT   CDS             complement(157493..158266)
FT                   /transl_table=11
FT                   /locus_tag="SUB0156"
FT                   /product="putative pyruvate formate-lyase activating
FT                   enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40596"
FT                   /db_xref="GOA:B9DT35"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT35"
FT                   /protein_id="CAR40596.1"
FT                   /translation="MTESGIVFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCANPESQKK
FT                   APEEMLTADCKGHETVGEQKTVSEVMEEVLKDRDFYEESGGGVTLSGGEIFAQYPFAKA
FT                   ILKEAKANGLHTAIETTAYAKPEHFKDLIQYVDFIYTDLKHYDSLRHRQVTGVTNNLIV
FT                   DNIHYAFSQGKEIVLRIPVIPDFNDSLEDAQAFSQLFNQLDIDKVQLLPFHQFGENKYK
FT                   LLNRDYAMADVPAYHPEDLEEYRQVFVNHHIKCYF"
FT   misc_feature    complement(157676..158197)
FT                   /locus_tag="SUB0156"
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 1.1e-21"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   misc_feature    complement(158150..158215)
FT                   /note="PS01087 Radical activating enzymes signature."
FT                   /inference="protein motif:Prosite:PS01087"
FT   misc_feature    complement(158207..158236)
FT                   /note="PS00473 Gonadotropin-releasing hormones signature."
FT                   /inference="protein motif:Prosite:PS00473"
FT   CDS             158393..159136
FT                   /transl_table=11
FT                   /locus_tag="SUB0157"
FT                   /product="DeoR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40597"
FT                   /db_xref="GOA:B9DT36"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT36"
FT                   /protein_id="CAR40597.1"
FT                   /translation="MNRLEKIIQLVSDHKRIDVNSLSELLGVSKVTVRKDLDKLESKGL
FT                   LRREHGYAVLNSGDDLNVRLSYNYNVKRKIAEKAAELVQDNDTIMIESGSTCALLAEVL
FT                   CQTKRNIKIITNSCFIANFLRQYDSCQIILLGGNYQPNSEVTVGPLLKQMVDLFHVDRV
FT                   FAGTDGFSPEVGFMCKDMMRCEGVQYMADAAEETIILTDSSKFSKPSLVHQLSLDRVSR
FT                   VITDKELDAENRNLLGSFGIALDFV"
FT   misc_feature    158399..159070
FT                   /locus_tag="SUB0157"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 1e-63"
FT                   /inference="protein motif:HMMPfam:PF00455"
FT   misc_feature    158399..158503
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00894"
FT   CDS             159152..160120
FT                   /transl_table=11
FT                   /locus_tag="SUB0158"
FT                   /product="putative sugar-binding regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40600"
FT                   /db_xref="GOA:B9DT37"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT37"
FT                   /protein_id="CAR40600.1"
FT                   /translation="MREEKRRLLAKLAYMYYIEEKSQTQIASEMGIYRTTVCRMLAKAK
FT                   EEGIVKIEISDYSPEIFALESYVQEKYGLKKVAIIPYHATDSQAERFDRIASEGAEFLR
FT                   SMVKDDEMIGISWGSTISRMIDRMDPKSLKGISVYPLAGGPSAINANFHVNTLVYRLAR
FT                   LFHGQSSFINATVIQENASIAQGIRESKYFEKTLEAWKKLDWAIVGIGAEPDSQKESQW
FT                   RDLLMGSDYEALRRLSAVGEICCRFFDKDGQPVNSHLQERTIGISIEELQKVPKVMAIA
FT                   HGHEKARAILAALKANCINYLVTDEATIRALLVADGDSFSQ"
FT   misc_feature    159212..159277
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1654.000, SD 4.82 at aa 21-42, sequence
FT                   KSQTQIASEMGIYRTTVCRMLA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    159317..160093
FT                   /locus_tag="SUB0158"
FT                   /note="HMMPfam hit to PF04198, Putative sugar-binding
FT                   domain, score 6.7e-93"
FT                   /inference="protein motif:HMMPfam:PF04198"
FT   CDS             160755..162020
FT                   /transl_table=11
FT                   /locus_tag="SUB0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40602"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT38"
FT                   /protein_id="CAR40602.1"
FT                   /translation="MSVNNEVLARNTELAPKTLGSHTVAFSHYNNFSAQLPLDPKTGQL
FT                   VEGGIREQAQQCFENLKAVIESIDHVLSDVVRLSIFVKDIQDVDTINLVQKEYFPTYAP
FT                   SRTVVAVDDLPMQAKVQMDAIISNGEGTIPNAPQAGDLIKLTNNTYNAPVSALSTQTVA
FT                   FSHYNNVTAQLPIDPKTGRLAIGGVKEQAIQCLKNIKAVLESIDVPLDDVVKMTVYVTD
FT                   LADLDVVNEVYKTFLPDSGIARAVNYLPARTVVPVAALEMGALVQMEATVSHGDGTPPQ
FT                   AIEDRHGLIIEHSNTEKAPKCEYSSQTVAFSHYNHISAQLPLAVSTGDLVAGGVKEQAQ
FT                   QCFDHIQAIIESVDHVMADVVKINVYMTDLADMASVEEVFSTVFAASKPALRFVGVSEL
FT                   PKGAMVQIDATVGNAEGTPPVA"
FT   misc_feature    160788..161138
FT                   /locus_tag="SUB0159"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 2.6e-24"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   misc_feature    161232..161576
FT                   /locus_tag="SUB0159"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 3.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   misc_feature    161640..161993
FT                   /locus_tag="SUB0159"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 7.3e-20"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   CDS             162243..164657
FT                   /transl_table=11
FT                   /gene="pflD"
FT                   /locus_tag="SUB0160"
FT                   /product="putative formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40603"
FT                   /db_xref="GOA:B9DT39"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT39"
FT                   /protein_id="CAR40603.1"
FT                   /translation="MTQTKPYFGQLTDRMNKYREAVLTKKPYIDAERALLVTETYKKHM
FT                   DKPANLKRAYMLQNILEHMTIYIEDDSFIAGNQASSNKDAPIFPEYTLEFVINELDLFE
FT                   KRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPKEVDVYMETGFFGMEGKMNSG
FT                   DAHLAVNYQKVLEYGLKGFEERARVAKDALDLTVPENIDKYHFYDSIFIVIDAVKTYAH
FT                   RYASLAREMAENASPERKAELLEIARICDKVPYQPAETFAEAVQSVWFIQCVLQIESNG
FT                   HSLSYGRFDQYMYPYAKADIEAGRETEDSIVERLTNLWIKTLTINKVRSQSHTFSSAGS
FT                   PMYQNVTIGGQTRDKKDAVNPMSYMVLKSVAQTKLPQPNLTVRYHKGLDNHFLNECIEV
FT                   MKLGFGMPAMNNDEIIIPSFIKKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYINF
FT                   PKILLITMNDGIDPSSGKRFAKGHGHFTEMTSYEELKAAWDETLREITRMSVIVENAID
FT                   LGLERECPDILCSALTDDCIGRGKTLKEGGAVYDYISGLQVGIANLSDSLAALKKLVFE
FT                   EKRLTTSELWWALETDFAGDRGEEIRQMLINDAPKYGNDDDYADQLVVDAYDTYIDEIA
FT                   KYPNTRYGRGPIGGVRYSGTSSISANVGQGKGTLATPDGRHAGTPLAEGCSPEHSMDKK
FT                   GPTSVLKSVSKLRTDEIVGGVLLNQKVNPQTLAKEEDKLKLMALLRTFFNRLHGYHIQY
FT                   NVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIERTEHTL"
FT   misc_feature    162273..164237
FT                   /gene="pflD"
FT                   /locus_tag="SUB0160"
FT                   /note="HMMPfam hit to PF02901, Pyruvate formate lyase,
FT                   score 4.5e-178"
FT                   /inference="protein motif:HMMPfam:PF02901"
FT   misc_feature    164283..164600
FT                   /gene="pflD"
FT                   /locus_tag="SUB0160"
FT                   /note="HMMPfam hit to PF01228, Glycine radical, score
FT                   1.1e-21"
FT                   /inference="protein motif:HMMPfam:PF01228"
FT   misc_feature    164565..164591
FT                   /note="PS00850 Glycine radical signature."
FT                   /inference="protein motif:Prosite:PS00850"
FT   CDS             164672..165340
FT                   /transl_table=11
FT                   /gene="fsaA"
FT                   /gene_synonym="fsa"
FT                   /gene_synonym="mipB"
FT                   /locus_tag="SUB0161"
FT                   /product="putative fructose-6-phosphate aldolase 1"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40606"
FT                   /db_xref="GOA:B9DT40"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT40"
FT                   /protein_id="CAR40606.1"
FT                   /translation="MEYMLDTLNVEDIKKWSAILPLAGVTSNPTIAKKEGDIDFFERIK
FT                   EVRSIIGEEASIHVQVVAQDYEGILKDAARIREHCGDSIYIKVPVTKEGLAAMKTLKAE
FT                   GYRITATAIYSIFQGLLAIEAGADYLAPYYNRMENLNIDAEAVIGQLAEAIDRECSDSK
FT                   ILAASFKNVGQVNKAFALGAQAITAGPDVFEAGFAMPSIQKAVDDFSADWESVHGQKQI
FT                   "
FT   misc_feature    164675..165331
FT                   /gene="fsaA"
FT                   /gene_synonym="fsa"
FT                   /gene_synonym="mipB"
FT                   /locus_tag="SUB0161"
FT                   /note="HMMPfam hit to PF00923, Transaldolase, score
FT                   3.6e-35"
FT                   /inference="protein motif:HMMPfam:PF00923"
FT   misc_feature    164921..164974
FT                   /note="PS00958 Transaldolase active site."
FT                   /inference="protein motif:Prosite:PS00958"
FT   CDS             165577..165894
FT                   /transl_table=11
FT                   /gene="qacH"
FT                   /locus_tag="SUB0162"
FT                   /product="putative quaternary ammonium compound-resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40609"
FT                   /db_xref="GOA:B9DT41"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT41"
FT                   /protein_id="CAR40609.1"
FT                   /translation="MAIVYLLLAILAEVIATSALKLTKGLTLLWPSLFCISIYMICHYY
FT                   FAKAIQDLNLGIAYALWCGVGILVTVFVSVLFYKESLSVTGILGILLILSGCLLVNLGG
FT                   N"
FT   misc_feature    165577..165855
FT                   /gene="qacH"
FT                   /locus_tag="SUB0162"
FT                   /note="HMMPfam hit to PF00893, Small Multidrug Resistance
FT                   protein, score 4.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00893"
FT   misc_feature    order(165580..165636,165649..165717,165742..165810,
FT                   165820..165888)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0162 by TMHMM2.0 at aa 2-20, 25-47, 56-78 and 82-104"
FT   CDS             165898..166782
FT                   /transl_table=11
FT                   /locus_tag="SUB0163"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40611"
FT                   /db_xref="GOA:B9DT42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT42"
FT                   /protein_id="CAR40611.1"
FT                   /translation="MSLQKSRLSNSFLVAMFVLPALIPLFVFWIYPILRTVWLSFTDWN
FT                   FMSPDYQIVLCDNYKSLLTDSRFYNALVNTLVFTLGTLGPTIIGGLILVLLLQKKTAGS
FT                   GFFKFILFSPWITPTVAISIVWTWIFEPKGGIANLILEAMHLPALSWLKSSQTAMLAVI
FT                   IVTVWKSLGYAMIFYLSALEKVPKDIYEASSLDGAKPWRQFIDMTLPSISPTTFFLMII
FT                   TMVNSLQAYDQIQILTQGGPSGSTRTLLYMYYQLGFEEYNMGQATAVAVIMVLITIVLS
FT                   YMQFVGSKKWVHY"
FT   misc_feature    order(165931..165999,166120..166188,166222..166287,
FT                   166369..166437,166522..166590,166678..166746)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0163 by TMHMM2.0 at aa 12-34, 75-97, 109-130, 158-180,
FT                   209-231 and 261-283"
FT   misc_feature    166099..166773
FT                   /locus_tag="SUB0163"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    166441..166527
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             166792..168444
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0164"
FT                   /product="putative fusion protein (pseudogene)"
FT                   /note="Possible pseudogene. No significant database matches
FT                   to the full length CDS. N-terminal region is similar to
FT                   Symbiobacterium thermophilum glycerol-3-phosphate ABC
FT                   transporter permease protein UniProt:Q67MC8 (275 aa) fasta
FT                   scores: E()=3.4e-19, 37.019% id in 208 aa. C-terminal
FT                   region is similar to Streptococcus dysgalactiae fibronecin
FT                   binding protein FnbA UniProt:Q06556 (1091 aa) fasta scores:
FT                   E()=2.8e-18, 36.512% id in 367 aa"
FT                   /db_xref="PSEUDO:CAR40613.1"
FT   misc_feature    167005..167532
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport s, score 5.8e-10"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    167671..167796
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 9.2e-12"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    167800..167925
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 9.6e-13"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    167929..168051
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 1.6e-10"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    168055..168177
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 1.6e-05"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    168304..168426
FT                   /locus_tag="SUB0164"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   7e-07"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    168328..168345
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS             complement(168496..169005)
FT                   /transl_table=11
FT                   /locus_tag="SUB0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40615"
FT                   /db_xref="GOA:B9DT44"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR027416"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT44"
FT                   /protein_id="CAR40615.1"
FT                   /translation="MKSDQQLQEVSYQLLAERGVHLNDIAQLVLSLQNKYIPSLTLEEC
FT                   LDNIQAVLKKREVQNAIITGIEMDKLAEQNQLSQPLLDILKADEGLYGIDEILALSIVN
FT                   LYGSIGFTNYGYLDKEKPGIIASLNSKDGKSCHTFLDDIVCAIAAAAASRLAHNDPDKS
FT                   AITNKK"
FT   CDS             169341..169679
FT                   /transl_table=11
FT                   /locus_tag="SUB0166"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40616"
FT                   /db_xref="GOA:B9DT45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT45"
FT                   /protein_id="CAR40616.1"
FT                   /translation="MENKILQEYISKRIRLLRLEKGLTQEQLEEKADLGTNYVYKLENQ
FT                   STNIKVNTLEKVMTALDVDFEEFFDISLVEQNSDLSDLMVQIKELSSGQQDRVIKALST
FT                   LVGEIKGK"
FT   misc_feature    169380..169544
FT                   /locus_tag="SUB0166"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.4e-13"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    169407..169472
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1359.000, SD 3.82 at aa 23-44, sequence
FT                   LTQEQLEEKADLGTNYVYKLEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             169816..170085
FT                   /transl_table=11
FT                   /locus_tag="SUB0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40618"
FT                   /db_xref="InterPro:IPR025868"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT46"
FT                   /protein_id="CAR40618.1"
FT                   /translation="MEKFCQSCAMPLMPKGQDFRGNNADASKSDTYCYLCYLNGQFTEP
FT                   NITFEEMVAKGQKGIEASPGNAISKWLMKKSYPMILKKVSRWQS"
FT   CDS             170159..171079
FT                   /transl_table=11
FT                   /locus_tag="SUB0169"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40619"
FT                   /db_xref="GOA:B9DT47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT47"
FT                   /protein_id="CAR40619.1"
FT                   /translation="MKFQDKHPILLGSLAALTCESLFGLSYLFTKSATSQSSPLALLGW
FT                   RFLLAFLFMQLLVTLGWVKLTIQGKSLGQLVKISFFSPVLYFIGETFGIKMTTASESGA
FT                   FLATIPVIALMASSILLREKPNRHQVMGIGLTLVGVLFTVFALGLSASFSIPGYLMLIL
FT                   AVIGYAFYSVHVEKATAFSGADMTYLMLLVGGLVFPILALVEAVLKHQLYELLLLPIRH
FT                   QAFSIAVLYQALACSVIAFFLSNFAIAKIGVNKAASFIGVSTLVSILAAVLFLGEAFSQ
FT                   YQTFGAFLIILGVYLSNIPIKQNKP"
FT   misc_feature    order(170177..170245,170288..170347,170381..170440,
FT                   170468..170521,170546..170605,170615..170683,
FT                   170720..170779,170837..170905,170924..170983,
FT                   170993..171061)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SUB0169 by TMHMM2.0 at aa 7-29, 44-63, 75-94, 104-121,
FT                   130-149, 153-175, 188-207, 227-249, 256-275 and 279-301"
FT   misc_feature    170219..170593
FT                   /locus_tag="SUB0169"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 1.2e-22"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    170654..171055
FT                   /locus_tag="SUB0169"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS             171148..171945
FT                   /transl_table=11
FT                   /locus_tag="SUB0170"
FT                   /product="RpiR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40621"
FT                   /db_xref="GOA:B9DT48"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT48"
FT                   /protein_id="CAR40621.1"
FT                   /translation="MTILSRFAEKENFTPTEQLIIDYLQSHQEELESLTIGQLAKGTFS
FT                   SNASIIRLCQKCGYQGFRDFRLALVSELTSSRYLGKIVDFSRPFQIKESSQEMVNSLFS
FT                   LYKSSIDQVQSLLDIPQLEEMAEQIAQSNRLFLFGYGDVKLTLKSFSNKLVKINYFPIM
FT                   ATENEEEHEIVPHITNGDVALFVSYRGKNEKMAQHIVSLRRQGVATFVITANQKSPLLP
FT                   YSKGYLLIPDLEKEDKIGTFYSQLSFDYLLNLIYTFLYKKHYD"
FT   misc_feature    171148..171477
FT                   /locus_tag="SUB0170"
FT                   /note="HMMPfam hit to PF01418, Helix-turn-helix domain,
FT                   rpiR family, score 6.7e-12"
FT                   /inference="protein motif:HMMPfam:PF01418"
FT   misc_feature    171523..171930
FT                   /locus_tag="SUB0170"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS             172080..173066
FT                   /transl_table=11
FT                   /locus_tag="SUB0172"
FT                   /product="oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40622"
FT                   /db_xref="GOA:B9DT49"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT49"
FT                   /protein_id="CAR40622.1"
FT                   /translation="MKLGIIGTGIIVQEFLPKLVKIEGIEVLGLQGIPQEMDLVKQLAA
FT                   ENGVAHAVSDFEALATLAIDTVYVAVPNFLHMHYSKQALQRGLNVIVEKPATSNDKELL
FT                   ELKGIAKENDVFIFEAVTTPYLKGFAKIKEWLPEIGDIKLVQSQYSQYSRRYDAFKEGT
FT                   ILPAFDPQKSGGALMDLNLYNLHFVMGLFGQPLSSTYLANMEKAIDTSGILSMTYPSFQ
FT                   ALCIAAKDSKGMTGALIQGDKGLIRTFAPANAIGKVVLEKYDGTVLSFEEDSFENRLIP
FT                   EFTEFITAINTKDQEFYEEAMARSLAVSRLQTQARLANQIIFPADQA"
FT   misc_feature    172080..172442
FT                   /locus_tag="SUB0172"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Ros, score 1.6e-17"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   misc_feature    172476..172799
FT                   /locus_tag="SUB0172"
FT                   /note="HMMPfam hit to PF02894, Oxidoreductase family,
FT                   C-terminal alph, score 0.024"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   CDS             173129..174298
FT                   /transl_table=11
FT                   /locus_tag="SUB0173"
FT                   /product="NADH:flavin oxidoreductase / NADH oxidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40623"
FT                   /db_xref="GOA:B9DT50"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT50"
FT                   /protein_id="CAR40623.1"
FT                   /translation="MDVLKDQIRLRHGAVLDSPIVQPPMLTYSGKKGGFASEETLAYYG
FT                   ARSQSAGMVITEFHYVSENGGPCSPLGFPEQLGIQDDDHIASIQAIAKAIKKDGSKAIL
FT                   QIHHGGYQAGARAAQGKEVLAVSELDVDFLPYPVREMTNEEIEEIIKDFGRATKRAIQA
FT                   GFDGVEIHGANHYLIQQFFSKTSNRRQDKWGGSLEKRMTFALEVVKEVKEVIAKEAPTD
FT                   FILGYRISPEEIHGSTVGYTYKESLALVSQLAKEDFDYISLSIWGGYASKPVGSEKSYG
FT                   QLFKEVVGPETKIMLVGSVFTEDQARDAIEHHTDLIGVGRGTLIDPQFALKIKENRGQD
FT                   IVQTISPEQVAKTGWTRGLREQFTKADAGGLPPLPGQDSILSLHQGLFD"
FT   misc_feature    173150..174148
FT                   /locus_tag="SUB0173"
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidas, score 3.3e-68"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS             complement(174324..175145)
FT                   /transl_table=11
FT                   /locus_tag="SUB0174"
FT                   /product="putative ribosomal RNA large subunit
FT                   methyltransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40624"
FT                   /db_xref="GOA:B9DT51"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT51"
FT                   /protein_id="CAR40624.1"
FT                   /translation="MSSFSQSVALFQCPICHMSLHLSGTSLLCPQRHTFDMAKQGYVNL
FT                   LLNAKKDPHYDKNSFIQRSRILEAGFYSHILEALKEELKSNQRLTILDVACGEGYYARA
FT                   LSENPSYQLLAFDLSKDSVLLAAKKDPQKRVSWFVGDLAKLPLADDSVDVILDIFSPAN
FT                   YQEFLRVLKPGGKLIKMVTASDHLQELREAAAAQLQSKTYSNQAIVDHFAEAFPDFNMT
FT                   HLSQTYPIEDKALAHFVQMTPLFFNVNTKAIPLASIHKITVAADMLVAQKH"
FT   CDS             175295..176320
FT                   /transl_table=11
FT                   /locus_tag="SUB0175"
FT                   /product="putative microcin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40626"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT52"
FT                   /protein_id="CAR40626.1"
FT                   /translation="MIKTVGIVSLSRGLLGEDFIKHELDLGIKRLEDYGLEVRFLPNAL
FT                   KGIDYIEEHPEARASDLLEAMADDSIDMILCAIGGDDTYRLLPHLFENKQLEKVAKQKI
FT                   FLGFSDTTMNHFMLHKVGIKTFYGQSFIADICELDKNMLPYTERYFRELMQTGSISEIR
FT                   PSEVWYEERQDFSENALGTQRTAHSNQGFELLRGPATFSGPILGGCLESIYDIFDNSRY
FT                   SDTVELCDKYNLFPSLEDWRGKILLLETSEEKPSVEEHRKMLEKLKATGIFNVINGIIV
FT                   GKPQDESHYQAYKENFLEVIDADIPILYNVNVGHATPRAIVPFGLMAHVDAEEQVIRFE
FT                   D"
FT   misc_feature    175520..175747
FT                   /locus_tag="SUB0175"
FT                   /note="HMMPfam hit to PF02016, LD-carboxypeptidase, score
FT                   1.5e-11"
FT                   /inference="protein motif:HMMPfam:PF02016"
FT   CDS             complement(176375..177301)
FT                   /transl_table=11
FT                   /locus_tag="SUB0176"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40628"
FT                   /db_xref="InterPro:IPR025672"
FT                   /db_xref="InterPro:IPR029101"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT53"
FT                   /protein_id="CAR40628.1"
FT                   /translation="MKSNDPLALLAKKRRRKTFLMTIVFSLLATLLLFALCFKLLSNMT
FT                   AKNGQKVYNDYQQLAEIAYPNISYNSLYYFPTGQFSGKVHADRFKDLDGIPVAYSPFEA
FT                   NYSLTGAFNAGASDVFSKNKLLYDRGNLQKIPQFYNTKVKFSKNDVKTSPSQDLKYLNQ
FT                   LNDKVIEVAITFDKPYTYKEIKTMLPKNLKQNWLWIGTYTTLDTSQWPNQFGTDTENIH
FT                   SAINTMFNVSKNSPHVGINNVNIYSDLDNYLKDNKHIKDVDQLSFAGIILTGKSENFNS
FT                   LKGKKWIYGSSLGASIDYQPYYQLDVE"
FT   misc_feature    complement(176474..176497)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(177176..177301)
FT                   /locus_tag="SUB0176"
FT                   /note="Signal peptide predicted for SUB0176 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.889) with cleavage site
FT                   probability 0.620 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(177176..177244)
FT                   /note="1 probable transmembrane helix predicted for SUB0176
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS             complement(177288..177827)
FT                   /transl_table=11
FT                   /locus_tag="SUB0177"
FT                   /product="RNA polymerase sigma factor protein"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40629"
FT                   /db_xref="GOA:B9DT54"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT54"
FT                   /protein_id="CAR40629.1"
FT                   /translation="MKIRKDSRKEDLHINIDAYEEEMMSYANEIIAYLMKSGVSPDQAQ
FT                   DVTQDVFVQILEANYSLPSSKLRAWMYRTAIRRYIDLYRRDKHYYDILKRDFFSQESLN
FT                   AYDQEGYDMLDEAISQVNEKFRILLDLFYFQNFSIKEIAEITGKSQSNIKITLMRARRQ
FT                   LKQELQSKGYTHHEIK"
FT   misc_feature    complement(177354..177419)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1460.000, SD 4.16 at aa 145-166, sequence
FT                   FSIKEIAEITGKSQSNIKITLM"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(177561..177764)
FT                   /locus_tag="SUB0177"
FT                   /note="HMMPfam hit to PF04542, Sigma-70 region, score
FT                   5.1e-06"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   CDS             177952..178881
FT                   /transl_table=11
FT                   /locus_tag="SUB0178"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40631"
FT                   /db_xref="GOA:B9DT55"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT55"
FT                   /protein_id="CAR40631.1"
FT                   /translation="MQKRILEMPTKRYQKLPAWLMILLACGMVQGFMLVGGLLAGIVFL
FT                   LFILFMIILRAGDTSILSHLSSMMNGLYFQLACFAFFSLTVMAWVKWYERRPLLSLGFY
FT                   KDKWFFEILKGWLIGTLLFALSVGLSYLLGGLAFKGFDFSPKTLCYVIGIIPLWFIQGG
FT                   TEELLTRGWLLPLIAKRSHLATAIIISSSLFGMMHLANDHVTVLSVVSIILVGIFMALY
FT                   MLKTDNIWGVAGIHGAWNFTQGNLCGLAVSGQASGPSILQFDSKVGAPEWLSGGAFGTE
FT                   GSLVASLVLLFGILILAWRFKRENSGKK"
FT   sig_peptide     177952..178119
FT                   /locus_tag="SUB0178"
FT                   /note="Signal peptide predicted for SUB0178 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.678) with cleavage site
FT                   probability 0.378 between residues 56 and 57"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(178009..178110,178153..178221,178294..178362,
FT                   178405..178473,178561..178620,178780..178848)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0178 by TMHMM2.0 at aa 20-53, 68-90, 115-137, 152-174,
FT                   204-223 and 277-299"
FT   misc_feature    178405..178692
FT                   /locus_tag="SUB0178"
FT                   /note="HMMPfam hit to PF02517, CAAX amino terminal protease
FT                   family, score 8.1e-15"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS             complement(178894..179364)
FT                   /transl_table=11
FT                   /locus_tag="SUB0179"
FT                   /product="Acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40632"
FT                   /db_xref="GOA:B9DT56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT56"
FT                   /protein_id="CAR40632.1"
FT                   /translation="MKLKHYQPQFKQDIEDFQVTREQLLFVRSPQDNIPLSEKVPSRKP
FT                   ILGFNNDGDCVVFFVLQEHSEFEKDFDLPNSIYVRSFVTDKRHLHRGYAKSALLALPQF
FT                   LKKEFPHIDYITLLVDHPNTIAKEMYHKCGFTEGKLIDGERYPAYTMIKAVK"
FT   misc_feature    complement(178957..179226)
FT                   /locus_tag="SUB0179"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 0.00058"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS             179709..180509
FT                   /transl_table=11
FT                   /locus_tag="SUB0180"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40633"
FT                   /db_xref="GOA:B9DT57"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT57"
FT                   /protein_id="CAR40633.1"
FT                   /translation="MVSIIFSDIDGTLLNDQHEVSSRTKTAIKECLRKGILFVPVSARM
FT                   PKAIKPITCSFLPEIPIISYNGAFVQDKTGYPISSSPMPFDVALSICSTVEEQFNDIVW
FT                   NIYSGEEWISQDRDNKWVKREEEIVSVTSIQMALETISHSLTIHKLLLMGEPGSIAKAE
FT                   RLFKENYSDLSIAQSYPYYLEIMASGITKGKAVTELATSYGVELGDTIAFGDNFNDLDM
FT                   LQTVGKGYVMGNAPTDLKSLIGDVTTDNNHDGIAEVLERTILTL"
FT   misc_feature    179712..180416
FT                   /locus_tag="SUB0180"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.00038"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    179718..179753
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    180345..180413
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS             180612..181580
FT                   /transl_table=11
FT                   /locus_tag="SUB0181"
FT                   /product="putative extracellular sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40634"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT58"
FT                   /protein_id="CAR40634.1"
FT                   /translation="MRHWLQKFSLFLILLMTSLLLIVYLIDQRIENLTKQRLSVGTTYM
FT                   TMNNPFYQVINAEIEKEITEKGGIVYTRDSSLNSAKQVEQLHYFIKTGVDVIVINPVKS
FT                   KDRNIKKAVEEAEQKGIKVIVIDSQLSKDVKVTSTIVSDNYHAGELLAKDLMSKKTSAR
FT                   ILLLEHKDAVSGEQRIKGFLDTISAQSQFKVMTKLESLGQTEIAMPAVEKIIQSQKDFD
FT                   VIMALNDQAAIGAVAALDKQKVDHPILVYGVDGSPDMKNLLATTSDVTATVSQSPLKMG
FT                   NQTARIAIKVANGESVPSKVTVPVKIITKKNIQDFDTKGWQ"
FT   misc_feature    180630..180689
FT                   /note="1 probable transmembrane helix predicted for SUB0181
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    180720..181544
FT                   /locus_tag="SUB0181"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 0.00052"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   CDS             181583..182917
FT                   /transl_table=11
FT                   /locus_tag="SUB0182"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40636"
FT                   /db_xref="GOA:B9DT59"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT59"
FT                   /protein_id="CAR40636.1"
FT                   /translation="MRGIKLVQFSKYSLLLINFLAVIFYASVFLFATQFISTQNESHAL
FT                   LEQLNAVPYRPELIFTVTVVLFFTLMTIIVFRDYSKSYKNRDSIDQLLLVELIVALGLL
FT                   VSLHFSYNGFLLLVFADVFFHFKDMYNLIEKRYWLFFLILSFGLLLLTDANVLSTFLPL
FT                   PDINTYINFFPIYLRIVLIFVKNFLTSINLIVFIISLIFYIMNAITEKHNLEEEVRMVS
FT                   QVNVELNNYVALTEKITEDRERKRISREIHDTLGHALTGISAGIDAVKVLIDIDPKKAK
FT                   NQLVSVSNVVREGIVDVRRSLKKLRPDALESRTLQDALNKIINDYQEISQIQIDFHYDW
FT                   QTADLSVAVEDIIFRVIQESITNSLRHGHASKIDITMSENNDYTITIKDNGIGAKEFSL
FT                   GYGLMQMRERLAIIGAQVTFNGEDGFETFITIPKTRSNYDKSNDS"
FT   misc_feature    order(181616..181684,181742..181810,181871..181939,
FT                   181997..182065,182126..182194)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0182 by TMHMM2.0 at aa 12-34, 54-76, 97-119, 139-161 and
FT                   182-204"
FT   misc_feature    182309..182512
FT                   /locus_tag="SUB0182"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   5.4e-24"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    182624..182884
FT                   /locus_tag="SUB0182"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.2e-12"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             182895..183575
FT                   /transl_table=11
FT                   /locus_tag="SUB0183"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40638"
FT                   /db_xref="GOA:B9DT60"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT60"
FT                   /protein_id="CAR40638.1"
FT                   /translation="MIKVMIADDQELIRESLKIVLSTHKDIVVTASVSDGFQVLEALEK
FT                   ELPDVILMDIRMPKMDGVVCTKEVKKRYPTIKIIILTTFDDDEFIFSALKYGASGYLLK
FT                   GVSMEELHQAIQTVFNGGAMINPDIAIKVFKAFSELPTLNNTIKVFEDEVESLSKAEWK
FT                   IIQQVGFGLSNREIAQKLFLSEGTVRNYLSNVLAKLQLRDRTQLAIWSVQTGVTVREIE
FT                   DDDD"
FT   misc_feature    182907..183263
FT                   /locus_tag="SUB0183"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5e-31"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    183354..183527
FT                   /locus_tag="SUB0183"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 2.8e-17"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    183405..183488
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    183408..183473
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1861.000, SD 5.53 at aa 168-189, sequence
FT                   LSNREIAQKLFLSEGTVRNYLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             183568..184872
FT                   /transl_table=11
FT                   /locus_tag="SUB0184"
FT                   /product="extracellular sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40639"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT61"
FT                   /protein_id="CAR40639.1"
FT                   /translation="MIKFETKKGQKLFLFGLILCFCFYFLTQQKAETVITLGIHEGSSW
FT                   DVPQGQDNHVLDDIIKNFEKKHPGVKVVYDSGIRKSDYSDWLADKIVTGKQPDVFMVPE
FT                   KDFNLFATNGVLYRLDKLIKKDIKPNQFYSVSYRSGSFRNSQYALPFESNPMMMCINKD
FT                   LLNQSGFDIPNQNWTMEDFYTIVKSTTKDTDGDNQIDQFGIVDYDWSYGMSAFGNAIFT
FT                   NDGSHVRLNTSRTKQAMHLITNLNSLSGSYQVSTQDFDKGKVVFRPMTMAEYRTYKPYP
FT                   YHVAKYSSFEWTCVPMPKEKGLHQTSQVDTSLFAISKRNKNVKLSWELLKSLTYDKRSQ
FT                   QELVKQSQGVSVLKDVMKSSTTKKILQEDNFGSNSLRVETLDRILKDGAEKPKFKLYNK
FT                   LNEEADYLISQSLKHDTIDLDLASIEKKLIESLRQ"
FT   misc_feature    183601..183654
FT                   /note="1 probable transmembrane helix predicted for SUB0184
FT                   by TMHMM2.0 at aa 12-29"
FT   misc_feature    183607..184587
FT                   /locus_tag="SUB0184"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   CDS             185018..185455
FT                   /transl_table=11
FT                   /locus_tag="SUB0185"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   fructose-specific family, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40640"
FT                   /db_xref="GOA:B9DT62"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT62"
FT                   /protein_id="CAR40640.1"
FT                   /translation="MKYLILVSHGDFAIGLKNTLAMFVEEKSDQVMAFGLKVGASVETF
FT                   AEDFRNQIKDLTVNDDIILLADIVGGSPLTTALEVLSDRNLLGQVTVLGGMNLPMAVTS
FT                   LLMKDELEGAAFVETVLFEARNGLQEFQLQGFDSDELEEDI"
FT   misc_feature    185021..185380
FT                   /locus_tag="SUB0185"
FT                   /note="HMMPfam hit to PF03610, PTS system fructose IIA
FT                   component, score 1e-21"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   misc_feature    185255..185341
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             185478..185972
FT                   /transl_table=11
FT                   /locus_tag="SUB0186"
FT                   /product="sugar phosphotransferase system (PTS), sorbose
FT                   subfamily, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40642"
FT                   /db_xref="GOA:B9DT63"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT63"
FT                   /protein_id="CAR40642.1"
FT                   /translation="MTVTFVRIDDRMIHGQTVTRWAKEYPCDGLIAVNDAAAANKVLTQ
FT                   AYKGASDKKTFVWSVDDFSKKSQKVLDSDTRYFVITKNPIDMKKLLVDQGFVPGNIKEI
FT                   IIGPANDRPGAIKLGNNQSITKDEAAAIEEIEALGYRVKFQLLPDVSIGYWSDFKNKFG
FT                   Y"
FT   misc_feature    185481..185939
FT                   /locus_tag="SUB0186"
FT                   /note="HMMPfam hit to PF03830, PTS system sorbose subfamily
FT                   IIB componen, score 1.4e-10"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   CDS             185991..186848
FT                   /transl_table=11
FT                   /locus_tag="SUB0187"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose family, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40644"
FT                   /db_xref="GOA:B9DT64"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT64"
FT                   /protein_id="CAR40644.1"
FT                   /translation="MTISWFQAVLLGIFASLASMPGMGGSSIGNYTLGRPLVGGLVCGL
FT                   ILGDLKLGIVCGVAMQLVYIALVTPGGTVSADVRAVSYIGIPLAMVAITAQGISVGSAS
FT                   AADLAKSMGTLVGTVGTVLFYGTATLNLAWQHIGWKAVEEGNFKKLYMVDWGLPWISHF
FT                   VFSFLPTLIMCKLGASAVTALQSALPMDGIAMKTLFTVGALLPCVGIAILLKQLVEKVT
FT                   DFIPFFVGFTLAASLGLNLVASAVISLIFALLFYEIDMAKLKVASRAVTDATDLDDFEE
FT                   EEDI"
FT   sig_peptide     185991..186068
FT                   /locus_tag="SUB0187"
FT                   /note="Signal peptide predicted for SUB0187 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.770) with cleavage site
FT                   probability 0.571 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    185997..186755
FT                   /locus_tag="SUB0187"
FT                   /note="HMMPfam hit to PF03609, PTS system sorbose-specific
FT                   iic component, score 1.6e-12"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   misc_feature    order(186015..186083,186126..186194,186228..186296,
FT                   186324..186392,186453..186521,186564..186632,
FT                   186669..186758)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SUB0187 by TMHMM2.0 at aa 9-31, 46-68, 80-102, 112-134,
FT                   155-177, 192-214 and 227-256"
FT   misc_feature    186327..186410
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   CDS             186850..187683
FT                   /transl_table=11
FT                   /gene="manZ"
FT                   /locus_tag="SUB0188"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose/sorbose family, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40646"
FT                   /db_xref="GOA:B9DT65"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT65"
FT                   /protein_id="CAR40646.1"
FT                   /translation="MVEIKKISKKTLTKSFHHWYYGHLTCFSQEHMQTFGYLTSMLPII
FT                   EELYNDKESQKKAMQTYTAFFNTEPQLGTIVVGVTAGLEEARANGESVDDEAINGMRAG
FT                   LMGPIAGIGDSLIVGTLIPVLLGIALGLSTDGSPVGAIFYIIVWNLLAYFGMKFAYFKG
FT                   YELGDKAVEFLVGPQGIAIRKAIGIVGGMVIGAVAATWVSVKTSFQLGSAKHPYLVLQN
FT                   QLDAVYPGLLTAIFIVFCWWLMAKKNMSPIKVMLLLVVIAFVGVLVGFFNPGLSY"
FT   misc_feature    186862..187662
FT                   /gene="manZ"
FT                   /locus_tag="SUB0188"
FT                   /note="HMMPfam hit to PF03613, PTS system
FT                   mannose/fructose/sorbose family I, score 1.1e-101"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    order(187168..187236,187264..187332,187393..187461,
FT                   187519..187578,187615..187674)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0188 by TMHMM2.0 at aa 107-129, 139-161, 182-204,
FT                   224-243 and 256-275"
FT   CDS             187707..188024
FT                   /transl_table=11
FT                   /locus_tag="SUB0189"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40647"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT66"
FT                   /protein_id="CAR40647.1"
FT                   /translation="MLSKEIVEGYETEISYQKHMIENLGRWLSLFLLISSIGIVWLYFF
FT                   YQTSIFLQAIGYFLLFLGIFGMSIFGYGIYKGKKNLQTIIFHFEQKIKYANTSKDRMLK
FT                   N"
FT   misc_feature    order(187776..187844,187854..187922)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0189 by TMHMM2.0 at aa 24-46 and 50-72"
FT   CDS             complement(188111..188713)
FT                   /transl_table=11
FT                   /locus_tag="SUB0190"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40649"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT67"
FT                   /protein_id="CAR40649.1"
FT                   /translation="MANYKKITSLSLLTLLSLATFSATQYSKVYAQDPESSSSVNIKTI
FT                   DGQLAIADKEAEPLYKEMDSIQMSIEKIKASRFKPAEIAITTEIQQLENLNETLLEKFY
FT                   QKIGNRIWNTKEEALNLISKTTLSPSEKELLKDYFNKDEVLQKKLKENDLLIDQETAQY
FT                   NAKLAILTQQADKIYEKHGITKDILAAYYMQTGMEAD"
FT   sig_peptide     complement(188621..188713)
FT                   /locus_tag="SUB0190"
FT                   /note="Signal peptide predicted for SUB0190 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(188815..190185)
FT                   /transl_table=11
FT                   /locus_tag="SUB0191"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40650"
FT                   /db_xref="GOA:B9DT68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT68"
FT                   /protein_id="CAR40650.1"
FT                   /translation="MKRKHLINQLFIINSLTLFLGFCLIFFSVNQVARRYVQQMTANAI
FT                   QGNFTIIDSIYEHKPIPDNQVAKKDSIYVWANYAIYDKDYQLKYTNSDQKKISNAIVSY
FT                   LNRHHLWSQASPRNGLFVPWKGKTYYVMVKDYHGKLEDDFIFKAKNGNSQPFHVINFSD
FT                   ITNTQKLIDQINLFLFLILIIIFFCMFLIMQRTFKGIQKSIHSVQDYISHLWRENNQKP
FT                   TKKERIIFSDFDPLLQESKEMAERIRQAEKSQLTFFQNASHELRTPLMSIQGYTEGLQA
FT                   GILDESSAYQVILEESQKMKTLVDDIMLLSRLDSKKQAHKQAVSLYDVLQESVSYIKPV
FT                   IMQKDLQLIQDYDDFQLMITGNSDLLEKAISNILSNALRYAENYIIIRACDHHIIIAND
FT                   GPPIAEKDLPYIFDRFYKGEKGQTGIGLSLVKEIVQQHQGKVKVTSHPEETQFIISF"
FT   misc_feature    complement(188821..189105)
FT                   /locus_tag="SUB0191"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.3e-22"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(189238..189429)
FT                   /locus_tag="SUB0191"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2e-18"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(order(189607..189666,190090..190158))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0191 by TMHMM2.0 at aa 10-32 and 174-193"
FT   sig_peptide     complement(190054..190185)
FT                   /locus_tag="SUB0191"
FT                   /note="Signal peptide predicted for SUB0191 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.793) with cleavage site
FT                   probability 0.782 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(190182..190871)
FT                   /transl_table=11
FT                   /locus_tag="SUB0192"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40652"
FT                   /db_xref="GOA:B9DT69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT69"
FT                   /protein_id="CAR40652.1"
FT                   /translation="MTQLIYLADDEKNIRDLLIPFLEHDGFKVKAFENGDLLYQEYLIN
FT                   QPDLIILDIMMPGSDGLTIMKKIRQRGDQLPIIMLTARDSDADFITAFQAGSDDYFTKP
FT                   FSPIKLVLHVKALLKRTVSTPLEQSTLFQYKGLSLNLDRRLCLLDDKELALTKTEFDLL
FT                   SLLIQKPETAFPRDELLNRIWGFEDIESRAVDDTIKRLRKKLKAHHSPVIIETVWGYGF
FT                   KLSVEEL"
FT   misc_feature    complement(190200..190424)
FT                   /locus_tag="SUB0192"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 1.1e-21"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(190506..190865)
FT                   /locus_tag="SUB0192"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2e-34"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS             complement(190928..191098)
FT                   /transl_table=11
FT                   /locus_tag="SUB0193"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40654"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT70"
FT                   /protein_id="CAR40654.1"
FT                   /translation="MFFHLSNKAFANLKRKIFDSLGNSFTFPKSLPFKKKPIATTLPQF
FT                   LQEKKGRFCYI"
FT   CDS             191177..193030
FT                   /transl_table=11
FT                   /locus_tag="SUB0194"
FT                   /product="transcriptional regulator (antiterminator)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40656"
FT                   /db_xref="GOA:B9DT71"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT71"
FT                   /protein_id="CAR40656.1"
FT                   /translation="MEEKYFEILELLSEDSYCSSVKLSEKLGISEKTARTRIKELDHQL
FT                   ETFGATITSKRGLGYSLVVTDQKQFLESVNRSSKNRSDGDVQDELFRFLLDMEDYQTID
FT                   DISAQLYISRSVLTNYLKKIEALLKLYDLSIDRKPHYGIKIIGSEANKRTCIQTNNLYP
FT                   LDDRDLIRKLMDYIIVGNQKYQVYMSEVAMEALINYIMISISRIKHHFPIEQIKTDRQE
FT                   ISQASQKIISDYINFIFKETKVYFNQYERDYLALQFTSKLASNSLSKFGPNFIISSQID
FT                   QLTFEMLDRVYKLLNLDFRNNLELRMALSQHLVPMDIRLRYNIMLENPLSEQIQKEYPF
FT                   PYTIASTAVTVLNEFYQKDISQGEMAYIALIFALATEKRNRDIAKKNILLVCISGTSSS
FT                   QLFKYKYLQAFGDYINKVYESSVSDLDFFDFKGNHIDYIFTTVPLSKKYPIPIYEINLF
FT                   IDTNDILTYKQFFEEGEKNYLLDYYSTNLFLPHLKASTKEDALKQMCQHISRYGITPDG
FT                   FYEAVLQRESLGQTAFGDIALPHPYKVLTEKSFVCVAILEEPIFWETKEIQVIFLMSIG
FT                   KEKADSLEEFYKTTSNIMFNEEAVKALIETPTFENLLQQLK"
FT   misc_feature    191228..191293
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1077.000, SD 2.86 at aa 18-39, sequence
FT                   CSSVKLSEKLGISEKTARTRIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    191477..191542
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1293.000, SD 3.59 at aa 101-122, sequence
FT                   QTIDDISAQLYISRSVLTNYLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    192029..192301
FT                   /locus_tag="SUB0194"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 8.7e-09"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    192608..193024
FT                   /locus_tag="SUB0194"
FT                   /note="HMMPfam hit to PF00359,
FT                   Phosphoenolpyruvate-dependent sugar phosph, score 0.0014"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   CDS             193205..193525
FT                   /transl_table=11
FT                   /locus_tag="SUB0195"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40657"
FT                   /db_xref="GOA:B9DT72"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT72"
FT                   /protein_id="CAR40657.1"
FT                   /translation="MSQEKILLVCSAGMSTSLLVTKMKDYINASGLDYEVNAVASSEAL
FT                   DYAVENKVNVILLGPQVRFMEGQFKKALAEYNIPIDLISPVNYGSMNGANVVKQAQELM
FT                   SK"
FT   misc_feature    193217..193510
FT                   /locus_tag="SUB0195"
FT                   /note="HMMPfam hit to PF02302, PTS system,
FT                   Lactose/Cellobiose specific IIB, score 6.9e-33"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS             193537..193845
FT                   /transl_table=11
FT                   /locus_tag="SUB0196"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40661"
FT                   /db_xref="GOA:B9DT73"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT73"
FT                   /protein_id="CAR40661.1"
FT                   /translation="MEQKDLETSMNLIIHAGNAKSSAMEAISLIKEGKAEECALKMKEA
FT                   DQEIAEAHKAQTQLLTKEANGEVTPFSLLLVHSQDHLMTAITFLDLAREVIDIYKHL"
FT   misc_feature    193552..193839
FT                   /locus_tag="SUB0196"
FT                   /note="HMMPfam hit to PF02255, PTS system,
FT                   Lactose/Cellobiose specific IIA, score 1e-40"
FT                   /inference="protein motif:HMMPfam:PF02255"
FT   CDS             193864..195174
FT                   /transl_table=11
FT                   /locus_tag="SUB0197"
FT                   /product="sugar phosphotransferase system (PTS), IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40662"
FT                   /db_xref="GOA:B9DT74"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT74"
FT                   /protein_id="CAR40662.1"
FT                   /translation="MGNKFLDKMTTVLGGFANWVNSLRYIIVIKNAFAALIPVIITGAF
FT                   GTLFSAMVFNAETGLARFEALRFLADLQPISSAISYVTLSFLTIYVVFLMGIELSKLNN
FT                   QNTVFAGIVAVMSYLSVNPTVFEFITETQKSVMVSNALAKQYTDTKGLFLGMIVAILSI
FT                   ELYCWLARQDKLQIKMPDTVPPSVAKSFSALFPTVITVATIATGGFIVKSITGLYAYDI
FT                   IYNIVQKPLEGVVQGLPGILLLVFVAQVFWVIGIHGNQMVKPIREPLLLAAIAVNTEAF
FT                   QAGKELPNIITMPFWDMYMSMGGSGVTIGLLVSIFLVGKRDDMKEITKLSIGPSIFNIN
FT                   EPVIFGMPIMLNPILAIPFIITPLVTGTIGYFATAMGFAAKAVVMVPWPTPPLINGYLA
FT                   TAGNWGAVATQAVCILVSILIYLPFVKIANREQLAQQ"
FT   misc_feature    193951..194952
FT                   /locus_tag="SUB0197"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 4.6e-59"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    order(193957..194025,194086..194154,194182..194250,
FT                   194311..194379,194437..194505,194563..194631,
FT                   194752..194820,194923..194991,195079..195138)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0197 by TMHMM2.0 at aa 32-54, 75-97, 107-129, 150-172,
FT                   192-214, 234-256, 297-319, 354-376 and 406-425"
FT   CDS             195183..196583
FT                   /transl_table=11
FT                   /locus_tag="SUB0198"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40665"
FT                   /db_xref="GOA:B9DT75"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT75"
FT                   /protein_id="CAR40665.1"
FT                   /translation="MKIRIPENFILGAATSAWQTEGWVGKKPGQDSFLDKWYQEEPFVW
FT                   HAGQGPNIATNFMEKYQDDIALMSEIGITHYRTSINWSRFFLDYEDLVVDEDYAMHIDK
FT                   VIDGLLAYNVQPIICMEHYELPYALMEKYDGWSSKTVVELFVNYADILFERYGDRVHQW
FT                   VTFNEPIVTQTRCYLDAIRWPHERNSKKWMLWNYHKTLATAKVVKLFHEKGYAGRVGCI
FT                   INPEMVYPRSSSTEDLEAARLYDLFYNRVFLDPMIKGSYSDEFLQLCKENDIYFNPSQE
FT                   ELALISENTLDFVGLNQYYPKRVKSQRFEWRKGEPFHPEKYVEDFQLPGRQMNQSRGWE
FT                   MYPKIMYDLSLYMMEYYPEIPWFIAENGMGQENESRYIDDSGIINDDYRIDFIAKHLYY
FT                   LLKGIEEGSKCEGYMLWAFTDCVSPMNAFKNRYGLISIDLEHNRERRMKKSAFWFKSLI
FT                   ENHSFDIK"
FT   misc_feature    195183..196571
FT                   /locus_tag="SUB0198"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase family,
FT                   score 1.2e-76"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   misc_feature    195801..195848
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   CDS             196704..197606
FT                   /transl_table=11
FT                   /locus_tag="SUB0199"
FT                   /product="6-phosphogluconate dehydrogenase family protein"
FT                   /note="Similar to the N-terminal regions of Saccharomyces
FT                   cerevisiae (Baker's yeast) GND2 6-phosphogluconate
FT                   dehydrogenase, decarboxylating 2 UniProt:6PG2_YEAST (492
FT                   aa) fasta scores: E()=3e-24, 37.209% id in 301 aa, and
FT                   Escherichia coli 6-phosphogluconate dehydrogenase,
FT                   decarboxylating Gnd UniProt:6PG9_ECOLI (468 aa) fasta
FT                   scores: E()=3.1e-22, 36.333% id in 300 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40667"
FT                   /db_xref="GOA:B9DT76"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT76"
FT                   /protein_id="CAR40667.1"
FT                   /translation="MMFGIIGLGKMGLNLSFNGVDHGQEMVVYDINQEAVATAAQYSEK
FT                   ITPATSVDELISKLPSPRIVWVMLPSGDITNTMIDYLINHLSHKDIIIDGGNSNYKDNL
FT                   KQAEVAKAAGINYFDVGTSGGMSGARNGANFMIGGDEEAWPLVEPIIAALAQEDGYLFT
FT                   GKVGSGHYLKMIHNGIEYGMMQAIAEGFEILDASPYDYDFEKVAKLWNHGSVIRSWLME
FT                   LAEQEFAKDPHLDKIQGRVQASGEGKWTVEESLDLEVPAPVIALSLMMRNRSLQDDTVT
FT                   GKVLAALRNGFGGHDVTRK"
FT   misc_feature    196710..197183
FT                   /locus_tag="SUB0199"
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconat, score 8.1e-30"
FT                   /inference="protein motif:HMMPfam:PF03446"
FT   misc_feature    197202..197600
FT                   /locus_tag="SUB0199"
FT                   /note="HMMPfam hit to PF00393, 6-phosphogluconate
FT                   dehydrogenase, C-ter, score 7.9e-05"
FT                   /inference="protein motif:HMMPfam:PF00393"
FT   CDS             197618..199045
FT                   /transl_table=11
FT                   /locus_tag="SUB0200"
FT                   /product="6-phospho-beta-glucosidase 1"
FT                   /EC_number="3.2.1.86"
FT                   /note="Similar to SUB0841, 50.535% identity (50.972%
FT                   ungapped) in 467 aa overlap (7-471:6-470); and SUB0905,
FT                   49.465% identity (49.677% ungapped) in 467 aa overlap
FT                   (7-471:8-474); and SUB0309, 47.689% identity (49.241%
FT                   ungapped) in 476 aa overlap (7-469:4-477); and SUB0837,
FT                   47.390% identity (49.348% ungapped) in 479 aa overlap
FT                   (7-469:5-480); and SUB0834, 43.788% identity (46.943%
FT                   ungapped) in 491 aa overlap (7-471:6-489); and SUB1579,
FT                   45.473% identity (48.253% ungapped) in 486 aa overlap
FT                   (3-471:5-479)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40670"
FT                   /db_xref="GOA:B9DT77"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT77"
FT                   /protein_id="CAR40670.1"
FT                   /translation="MKENDTFPKDFLFGGAIAANQAEGAWKEGGRGESNIDYIPHGNDR
FT                   MTVKLGYQPNPILDDQHYYPSHTGIDFYHKYDQDFDLLEELGLDIFRTSISWSRLYPNG
FT                   DESQPNPEGIAFYKQLFESCRNHHMKLLVTLAHFDIPMGLVRGYGSWRNKKVIDFYVRF
FT                   AETCFKEFGDYVDYWITFNEINIVLHSPFSGAGLAIQENENRDQVLFQAAHHMLLASSL
FT                   AVKSFKTLCPNSQIGCMIAGGSFYPYSCAPDDVWQAMMDDRLNTFFVDVQVNGRYPFYF
FT                   KNILKEKNISLEVTPEEAEILKSTVDFVAFSYYSSRTSIGDTSKVEMNSGNVVKSVKNP
FT                   YLKQSDWGWAIDPKGLRITINNLYEKYKKPLFIVENGFGAQDVLEEDNAIHDSYRISYM
FT                   NEHLKEVANALDDNIPLIGYISWGILDLVSASTGEMKKRYGVIYVDKDDAGNGSFARYK
FT                   KDSYYWYQKVIANRKLT"
FT   misc_feature    197624..199039
FT                   /locus_tag="SUB0200"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase family,
FT                   score 8.3e-145"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   misc_feature    197648..197692
FT                   /note="PS00653 Glycosyl hydrolases family 1 N-terminal
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00653"
FT   misc_feature    198728..198754
FT                   /note="PS00572 Glycosyl hydrolases family 1 active site."
FT                   /inference="protein motif:Prosite:PS00572"
FT   CDS             199056..200492
FT                   /transl_table=11
FT                   /locus_tag="SUB0201"
FT                   /product="putative gluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40672"
FT                   /db_xref="GOA:B9DT78"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT78"
FT                   /protein_id="CAR40672.1"
FT                   /translation="MMNYILGIDIGTTATKGILYKSDGQAISSHSRSNQLLRGTDGQAE
FT                   QDPNAIYQGIVELIQEVTARLTPEDCLDAVAFSCQMHSLILLDDNWSLLTPSITWADTR
FT                   AQSYAEAIKDSEVGQKFLGTSGTPIHPMSWLAKMKYFKVEEPQLIAKTAHLMGIKDYVF
FT                   YQFFGVNLTDISSATGTGLVNLELSDWDQGILDYLGLSNQLLPEIKDSIDYIEGIPQVL
FT                   HGLNGITDKTRFIFGAGDGPMANLGIGKMPEHAAVITVGTSSAVRFMSKDLQVEENGSL
FT                   FTYAVKKGLWVIGGPSNSGGNILEWLHKTFYESQPMERIFQDIKSVEIGAEGLCFLPYL
FT                   GGERAPIWDSEIRGSFHNLSFTHQKAHFARACMEGLFYNIRMILETIEEHFPVDTLYVS
FT                   GGLFQTQLFIELLADVTGKVVVQSEEKEVGCRAAFLLSKEVLGQGFISQSIEKRYLPNP
FT                   THFQHYTKSYEKSFKPLLKR"
FT   misc_feature    199065..199796
FT                   /locus_tag="SUB0201"
FT                   /note="HMMPfam hit to PF00370, FGGY family of carbohydrate
FT                   kinases, N-termi, score 6.1e-51"
FT                   /inference="protein motif:HMMPfam:PF00370"
FT   misc_feature    199806..200450
FT                   /locus_tag="SUB0201"
FT                   /note="HMMPfam hit to PF02782, FGGY family of carbohydrate
FT                   kinases, C-termi, score 3.7e-24"
FT                   /inference="protein motif:HMMPfam:PF02782"
FT   misc_feature    199809..199844
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             complement(200543..201598)
FT                   /transl_table=11
FT                   /locus_tag="SUB0202"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40674"
FT                   /db_xref="GOA:B9DT79"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT79"
FT                   /protein_id="CAR40674.1"
FT                   /translation="MTNKKDYQISLRRYFVILYLIIFLITSLFGMATIVFLKECLHVTG
FT                   SFTLWLLIYSIVILILGALIMWFGSTHLTKPISDLNQSVKAISQGDFSRKIVRKSYPKD
FT                   RATYHNEIDELSQNINQMANDIKNADRHRSQFIANLSHELKTPISSLVGISDLLLTDSL
FT                   EKDTRTELTTILQSESLRLSRLCDDILNLTKLENHLSPQLESVALDEQIRQALIMLTEK
FT                   WKSKTIHLEFDGEAVMCQTDPDLTMQVWVNVIDNAIKYSSDQVFLNVDVKQATDKVLVT
FT                   ISDKGIGIAKENQRHIFEQFYQADQSHAQEGNGLGLAIVKKIIDSLNGSIHFESTPGQG
FT                   SRFYITLPTNQ"
FT   misc_feature    complement(200549..200878)
FT                   /locus_tag="SUB0202"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.3e-34"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(201005..201205)
FT                   /locus_tag="SUB0202"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 5.7e-17"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(201215..201448)
FT                   /locus_tag="SUB0202"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 5.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(order(201386..201454,201488..201556))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0202 by TMHMM2.0 at aa 15-37 and 49-71"
FT   CDS             complement(201591..202274)
FT                   /transl_table=11
FT                   /locus_tag="SUB0203"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40676"
FT                   /db_xref="GOA:B9DT80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT80"
FT                   /protein_id="CAR40676.1"
FT                   /translation="MFTILVAEDDFAINKMITTKLEQEHYTVHSVTNGQEALSVMENHQ
FT                   IDLIITDIMMPIMDGYSLLKTLRETLYKTPVLMITAKSQLESLETAFKLGVDDYLVKPI
FT                   RLPELSLRVQALLRRSQLESDRQLSFKGSRLEFDAQTLTYLDSNERLQLPQKEFLLLYK
FT                   LMSHPEKIFTRLDLLDDIWGMEEDRDERLVDACVKRLRQKIQNNPDFDILTVRGLGYKG
FT                   SLRND"
FT   misc_feature    complement(201609..201833)
FT                   /locus_tag="SUB0203"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 4.6e-16"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(201912..202271)
FT                   /locus_tag="SUB0203"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 4.9e-38"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS             complement(202309..202989)
FT                   /transl_table=11
FT                   /locus_tag="SUB0204"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40677"
FT                   /db_xref="GOA:B9DT81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT81"
FT                   /protein_id="CAR40677.1"
FT                   /translation="MPILTLNHISKSFQDGNQRRQILKDVSLKVNPKEFVAILGPSGSG
FT                   KSTLLSIAGLLLSADNGNIIIGDQDLTQLKQAQWTQKRKELLGFIFQDHQLLSYMTIGE
FT                   QLDLVAKMKGSQDKAENQESIKTLLAELGIEDSYQQYPKQMSGGQKQRAAIARAFIGNP
FT                   QLILADEPTASLDPKRGQEIARLIQKEVKEKEKAALMVTHDRSILEYVDTIYSLSDGQL
FT                   IKHS"
FT   misc_feature    complement(202330..202893)
FT                   /locus_tag="SUB0204"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(202513..202557)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(202849..202872)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(202991..204070)
FT                   /transl_table=11
FT                   /locus_tag="SUB0205"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40678"
FT                   /db_xref="GOA:B9DT82"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT82"
FT                   /protein_id="CAR40678.1"
FT                   /translation="MKVSWSEIRYQPKKFLLIELLIVLMMFMVIFLSGLTNGLGRAVSA
FT                   QIDHFGSVTYLLSEDAEGIIPFSSIENNDKSLFKEDQLGELVIQRSAIIPKEKKETLDL
FT                   TYFATNHQSFLQAKKEDGTAFYPGKNEVILDDSFQAKGIALGDQVTDKASQVTLTVRGF
FT                   AKEAFYGHSALAFISADTYTAMRQKKDPHYSWQAQALVTKQNLSQIKLPNHLKAYQKQA
FT                   IIQKIPGYMAEHLTLTLITWVLLIASSAILGVFFYILTLQKLKQFGVLKAIGMSMTQIS
FT                   VIQLSQIGFLALFGVISGLSLAILLAQVLPRSMPFYMTLESSLLVSISFVMIATACGAL
FT                   SLLKIRKVDPLDVIGGNGE"
FT   misc_feature    complement(203021..203461)
FT                   /locus_tag="SUB0205"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   5.3e-15"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(order(203036..203104,203141..203209,
FT                   203288..203356,203960..204028))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0205 by TMHMM2.0 at aa 15-37, 239-261, 288-310 and
FT                   323-345"
FT   sig_peptide     complement(203936..204070)
FT                   /locus_tag="SUB0205"
FT                   /note="Signal peptide predicted for SUB0205 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.893 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(204173..205630)
FT                   /transl_table=11
FT                   /locus_tag="SUB0206"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40682"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT83"
FT                   /protein_id="CAR40682.1"
FT                   /translation="MVKKQVAIIGMGVSGLAVLLALSQLPDKLLEKIDITCFDDPKHFG
FT                   RGIPFQEDSSTAWINSPIDAISYDYHDMNDFQNWMEQKGLDTDQSYVPRSLYGRYMTER
FT                   AHDLLQKLKASVIHEKVTQLNYEPDSQKWNIGTSQRTIPTRFDEVHLTCGELPVLDPYH
FT                   LQGNPNYIADPYPLKNLPKQPGKKDRIAIIGTGLASIDTLKWLLKNSQADLLAFSPSMT
FT                   FPTVRILKKETIDWQFLTDTNKQKLFEENSFNFKSLENLFLSELQALGFQNWEETCRQF
FT                   LAEGIPGISLSLAFPAQLFLLQQLASHLVDWLTDFWPQMTLSDRQYYKENYGKAIINLR
FT                   NPMPEEAGRLLIEATAQGRLQIIEAVTDIEAGNYGFVLKREVGKELSVATVINATGYHL
FT                   KESNVHQARTLIQQVIRDGLVQINPEGGLSILPQTGQVISPKYGILATLYAHGSLVNGV
FT                   IYQNNSTIKIQQMAERAIGNVIKKPTI"
FT   misc_feature    complement(205553..205612)
FT                   /note="1 probable transmembrane helix predicted for SUB0206
FT                   by TMHMM2.0 at aa 7-26"
FT   sig_peptide     complement(205562..205630)
FT                   /locus_tag="SUB0206"
FT                   /note="Signal peptide predicted for SUB0206 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.752) with cleavage site
FT                   probability 0.746 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(205780..207279)
FT                   /transl_table=11
FT                   /locus_tag="SUB0207"
FT                   /product="putative surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40684"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT84"
FT                   /protein_id="CAR40684.1"
FT                   /translation="MKSYLKRRYGLITTSVLAATVLATGWQSTSVLAENPTTSPTTTVT
FT                   SNGFNFNATLLDHNGKTVSGKTVSLYDITDGNRTLVQSAVSDQNGIASFSQLPLNRNLS
FT                   VFVDNVAQGYTTRTSESGQVRSSAFYIDGQGTNTPKYSDKTITISVLNEEAEPLANQKV
FT                   TLTNPLKEVVGEAMTDADGHVVFKDKLLEGVFYNYAVNGKAIDSAQPDSKRSVFLESNQ
FT                   LAKEGFTFTATILGKNGKTVAGKTVSLYDITDGNRTLVQSAVSDQNGIASFSQLPLNRN
FT                   LSVFIDDVAQGYTTRTSENGQVRSSAFYVDGQGTNTPKYSDKTITISVLNEEGEPLANQ
FT                   KVTLINPLKEVIGEANTDANGKVIFTDKLLDGVFYTYAVNDQTIDATQPDTSRNVFLRA
FT                   DQILKESPKNTASEAATNLEKTTESKEGNMPQQNQSEAKEKAPEKQVDANAANKKAPGH
FT                   GEAKKGLPMAGERGSRLFTFIGLSLILGIAGYLLKHKKVKS"
FT   misc_feature    complement(205789..205911)
FT                   /locus_tag="SUB0207"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   0.0041"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    complement(205804..205857)
FT                   /note="1 probable transmembrane helix predicted for SUB0207
FT                   by TMHMM2.0 at aa 475-492"
FT   misc_feature    complement(206542..206565)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(207079..207102)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(207181..207279)
FT                   /locus_tag="SUB0207"
FT                   /note="Signal peptide predicted for SUB0207 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(207481..207756)
FT                   /transl_table=11
FT                   /locus_tag="SUB0208"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40685"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT85"
FT                   /protein_id="CAR40685.1"
FT                   /translation="MVKNDLPKIREENRLLTIILLTYFVSVTSIYLVGYPKLSSFLLFV
FT                   NVIVIIYYLVTSQGKHTVKLIISLILALLLFFLHVFFLIAHLMPIH"
FT   misc_feature    complement(order(207496..207564,207589..207642,
FT                   207652..207720))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0208 by TMHMM2.0 at aa 13-35, 39-56 and 65-87"
FT   CDS             complement(207749..208159)
FT                   /transl_table=11
FT                   /locus_tag="SUB0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40686"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT86"
FT                   /protein_id="CAR40686.1"
FT                   /translation="MFKYYQPDYINRVKAELGYDSDSLNINVRNNAASFGRIMLLGHLA
FT                   ALTSKFYHLFLEKDGLLFIQRGTYSNKLLKDKSFFISHDAIQEVVLKKGPISYKMTIVD
FT                   TENKKTHFLINKVLLGAPWQKESLAKLIEIYG"
FT   CDS             complement(208306..208869)
FT                   /transl_table=11
FT                   /locus_tag="SUB0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40688"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT87"
FT                   /protein_id="CAR40688.1"
FT                   /translation="MKLTIFCGASTGKHPMYRERARELALWMSDNHHDLVYGGGKVGLM
FT                   GVVADSIIENGGTAIGVMPTFLKDREIAHDYLTELIVVDDMPKRKAKMMALGQAFIALP
FT                   GGPGTLEEISEVISWSRIGQNDKPCILFNINGYFNALRDQFDHMVLEGFLSQSDRDIIL
FT                   FSDDLTEIETFIKSYKGPNIRNYR"
FT   misc_feature    complement(208336..208737)
FT                   /locus_tag="SUB0210"
FT                   /note="HMMPfam hit to PF03641, Possible lysine
FT                   decarboxylase, score 6.8e-54"
FT                   /inference="protein motif:HMMPfam:PF03641"
FT   CDS             complement(209013..209132)
FT                   /transl_table=11
FT                   /locus_tag="SUB0211"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40692"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT88"
FT                   /protein_id="CAR40692.1"
FT                   /translation="MKALSTVSFAYNENLITLLDIAFFLYLATTYRPFRGNAI"
FT   misc_feature    complement(209031..209090)
FT                   /note="1 probable transmembrane helix predicted for SUB0211
FT                   by TMHMM2.0 at aa 15-34"
FT   CDS             209191..209535
FT                   /transl_table=11
FT                   /locus_tag="SUB0212"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40696"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT89"
FT                   /protein_id="CAR40696.1"
FT                   /translation="MENLGQILAFIVFLLVVWFIFSSLFKGMAKATKTRGYNYTIHFVN
FT                   TDKEIELTENSRVMALLQIISHSKGNNVYTVLSKRNDKTLKELLMAEYHLQANQVAITP
FT                   LQNAGPLASV"
FT   sig_peptide     209191..209283
FT                   /locus_tag="SUB0212"
FT                   /note="Signal peptide predicted for SUB0212 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.805) with cleavage site
FT                   probability 0.710 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    209200..209265
FT                   /note="1 probable transmembrane helix predicted for SUB0212
FT                   by TMHMM2.0 at aa 4-25"
FT   CDS             209554..209913
FT                   /transl_table=11
FT                   /locus_tag="SUB0213"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40700"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT90"
FT                   /protein_id="CAR40700.1"
FT                   /translation="MLTSFLIASEKTTIVVGEIAVLLLIIGFCYQLFRLKNLKKSEKPY
FT                   RTLIKVTDPTIQIDDFPEIKAMTNWTFQNSQKAWIGQTSLHPNEMRHLVKEHYPTKADA
FT                   ITIQLIPYTWWIINK"
FT   misc_feature    209590..209658
FT                   /note="1 probable transmembrane helix predicted for SUB0213
FT                   by TMHMM2.0 at aa 13-35"
FT   tRNA            complement(209967..210039)
FT                   /gene="tRNA-Lys"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:210004..210006,aa:Lys)"
FT                   /note="tRNA Lys anticodon CTT, Cove score 81.69"
FT   CDS             complement(210334..211602)
FT                   /transl_table=11
FT                   /locus_tag="SUB0214"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40703"
FT                   /db_xref="GOA:B9DT91"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT91"
FT                   /protein_id="CAR40703.1"
FT                   /translation="MPDNLALRMRPRTISEVIGQEHLVGEGKIIRRMVDANMLSSMILY
FT                   GPPGIGKTSIASAVAGTTQYAFRTFNATTDSKKRLQEIAEEAKFSGGLVLLLDEIHRLD
FT                   KTKQDFLLPLLENGNIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEAIKKAIATAI
FT                   KDKERGYNFPIELDQDALDFIATATNGDLRSAYNSLDLAVMSTQANEAGLRHITLDTVE
FT                   NSLQRSYITMDKNGDGHYDVLSALQKSIRGSDVNASLHYAARLVEAGDLPSLARRLTVI
FT                   AYEDIGLANPDAQIHTVTALDAAQKIGFPEARILIANVVVDLALSPKSNSAYQAMDAAI
FT                   SDLKKSGNLPIPRHLRDGHYSGSKELGNAQNYLYPHAYPEKWVKQQYLPDKLVGRHYFE
FT                   ANETGKYERALGANKARIDKLSQ"
FT   misc_feature    complement(210952..211482)
FT                   /locus_tag="SUB0214"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.2e-18"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    complement(211444..211467)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(211860..212147)
FT                   /transl_table=11
FT                   /locus_tag="SUB0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40704"
FT                   /db_xref="InterPro:IPR025384"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT92"
FT                   /protein_id="CAR40704.1"
FT                   /translation="MEKNTLPSLEEKYQHFSQIQAQFAETLENYQQNYQDFVQLRAFYG
FT                   SDDWYESRQTPNDADAFSILSEDTLYNLFVEHSGLLEKMLDQSAKMYKSL"
FT   CDS             complement(212181..212336)
FT                   /transl_table=11
FT                   /locus_tag="SUB0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40706"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT93"
FT                   /protein_id="CAR40706.1"
FT                   /translation="MRFAMHWEVLTMTKSKRWRPVPTVTKFDTEQEAIDFKNSLKQYCE
FT                   LYQVNG"
FT   misc_feature    212584..221800
FT                   /note="prophage or prophage remnant"
FT   repeat_region   212584..212607
FT                   /note="24mer direct repeat flanking putative phage region"
FT   CDS             complement(213955..214725)
FT                   /transl_table=11
FT                   /locus_tag="SUB0217"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40708"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT94"
FT                   /protein_id="CAR40708.1"
FT                   /translation="MMKTLSDTPNTYTFTATLPNFEQAQRAGSALIGYMIGTYEQSVID
FT                   ITYTGNGDIEVEYTSDEDLTENFERITNSLDHTDDFEDYEEDEPTLKGDLDAYTALIGS
FT                   FETLGQAQAFTENLDDDLTNGNNFVFEQRPDAVVVYVSPQDTIANSTIQKLEEAYVKFE
FT                   ADYEPDDFRLNYLDMRVQQLQSLDKDTLISDIINYELELLDYADRLLSDEPLPLNSLDG
FT                   YDTMELLGDEVIDLVKTLDTDKQFDGIHDYIIGG"
FT   CDS             complement(214817..214999)
FT                   /transl_table=11
FT                   /locus_tag="SUB0218"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40709"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT95"
FT                   /protein_id="CAR40709.1"
FT                   /translation="MKIELLKREPTPSRGYHEKETFYDFEARVNDFIADKKVIDIKLQG
FT                   NNEDPLIMVMYHETN"
FT   CDS             complement(215002..215154)
FT                   /transl_table=11
FT                   /locus_tag="SUB0219"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40710"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT96"
FT                   /protein_id="CAR40710.1"
FT                   /translation="MKKYKDITETFRNIDEAMAFLKILYRYDTTIKVTMRELNGKEPYY
FT                   IIERG"
FT   CDS             complement(215499..216938)
FT                   /transl_table=11
FT                   /locus_tag="SUB0220"
FT                   /product="putative phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40712"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT97"
FT                   /protein_id="CAR40712.1"
FT                   /translation="MRELYNLLFNIGKQWREDNEYIVNEGKKNERVEIPRPNVSTVANI
FT                   LKKHCHFTFIGYGQISDISKLYFYHLDFGYYVASDDILRKLIIKFDSRLTTAKFYNEVI
FT                   AYLRTETFMREPMQAYNYIPVKNGVYNILTQKLEPFDPKFIITSKIATPFNPDAKKPIL
FT                   NGWFDFDKWFDSLACNDSEVVTLLWQIMNEAINPNRTRKKMVILTGDGNNGKGTFQALL
FT                   ENLIGKENISNLKPDQFKEFYTNALEGKTCNIGDDISNKYLDEVSDLMSIVSGDRIQVN
FT                   RKGKETFEATYRLLCIFSGNDIPRARNKTNGWYRRLCIVPFNADFNGNKERPEIKDKFI
FT                   RNKSLLEWILFKILTMKDFDKFIEPKVVTKMLDQYKRDNDYILTFVTEFYIPKGWHEVN
FT                   HVPMFVIRKALEEFLSDIGAEKASKVNFGNQIIKILEKMTSNKYEAKNGTVSPKAMSII
FT                   DPLGFQSERIKKGVWGLHKMD"
FT   misc_feature    complement(215628..216572)
FT                   /locus_tag="SUB0220"
FT                   /note="HMMPfam hit to PF03288, Poxvirus D5 protein-like,
FT                   score 1.4e-76"
FT                   /inference="protein motif:HMMPfam:PF03288"
FT   misc_feature    complement(216927..216938)
FT                   /note="PS00228 Tubulin-beta mRNA autoregulation signal."
FT                   /inference="protein motif:Prosite:PS00228"
FT   CDS             complement(216998..217867)
FT                   /transl_table=11
FT                   /locus_tag="SUB0221"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40715"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT98"
FT                   /protein_id="CAR40715.1"
FT                   /translation="MTIYEVQGVKRPILNEYKGNLTPFDYIAKIKPMKPPENMTIDDFK
FT                   QSHAPYCIAGKVKPDKNRIYKRSNATLIYRDLVFIDYDDITISPETFKDTVHSVLSDYS
FT                   YILYPTIKHTPEKPRYRLVVKPDSNLTEPDYKATVNQIANLIGLPYDQTSETWSQLQGL
FT                   PVTRLEVDQYDRVVNLGTDFPTIRGQTVTTQPISRNFNNTSGQLSITMRVINTLFNGFG
FT                   EQGGRNVALTKFVGLLLNKYVNCDIESAYDLALIANENTEPPLTINEFDTTFRSILNAE
FT                   MRKRGIQP"
FT   CDS             complement(217868..218137)
FT                   /transl_table=11
FT                   /locus_tag="SUB0222"
FT                   /product="putative DNA-binding phage protein"
FT                   /note="Similar to SUB1831, 85.393% identity (85.393%
FT                   ungapped) in 89 aa overlap (1-89:1-89)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40717"
FT                   /db_xref="GOA:B9DT99"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B9DT99"
FT                   /protein_id="CAR40717.1"
FT                   /translation="MTWLSKEAENDIKKEVAITVTTILENFQKPEPRLLGLITQSDLKK
FT                   ELDIDYNTLRRWEDNGLPRYQAPLEDTRKVFYKVSDILAFLGAE"
FT   misc_feature    complement(217961..218026)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1615.000, SD 4.69 at aa 38-59, sequence
FT                   ITQSDLKKELDIDYNTLRRWED"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             complement(218149..218340)
FT                   /transl_table=11
FT                   /locus_tag="SUB0223"
FT                   /product="putative phage membrane protein"
FT                   /note="Similar to SUB1832A, 82.540% identity (82.540%
FT                   ungapped) in 63 aa overlap (1-63:1-63)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40718"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA0"
FT                   /protein_id="CAR40718.1"
FT                   /translation="MQELNLTIGQMLVLLPLLILLLLITLRKHSYLEIDLPDIEQRTNK
FT                   GINPNYGAYIQAQSKYYN"
FT   misc_feature    complement(218263..218331)
FT                   /note="1 probable transmembrane helix predicted for SUB0223
FT                   by TMHMM2.0 at aa 4-26"
FT   CDS             complement(218328..218504)
FT                   /transl_table=11
FT                   /locus_tag="SUB0224"
FT                   /product="hypothetical phage protein"
FT                   /note="Similar to SUB1834, 74.138% identity (74.138%
FT                   ungapped) in 58 aa overlap (1-58:1-58)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40719"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA1"
FT                   /protein_id="CAR40719.1"
FT                   /translation="MLNEILEHQPIDDSILEAIEIYNEGMRITNSNALSLQRVYNAGMI
FT                   AGKRIERAKKCKN"
FT   CDS             complement(218497..218709)
FT                   /transl_table=11
FT                   /locus_tag="SUB0225"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40721"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA2"
FT                   /protein_id="CAR40721.1"
FT                   /translation="MENHTMKNEVFEIRDYLVENNYPKGFIFMLDDYFTNKAISKEEIN
FT                   NIMSLPKEEYQHFINNYQLRGANNA"
FT   CDS             complement(219002..219295)
FT                   /transl_table=11
FT                   /locus_tag="SUB0227"
FT                   /product="hypothetical phage protein"
FT                   /note="Similar to SUB1836, 75.000% identity (75.000%
FT                   ungapped) in 96 aa overlap (1-96:1-96)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40723"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA3"
FT                   /protein_id="CAR40723.1"
FT                   /translation="MAYLPEERETVIIYDEKSNTWQFETTVRRHITKILKSSEAFDDIA
FT                   QEFDGSNCISVRATLSNLDDFSVNPFVKSKRKMTDKQKQELADRLKRNLSKI"
FT   CDS             complement(219342..219548)
FT                   /transl_table=11
FT                   /locus_tag="SUB0228"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40724"
FT                   /db_xref="GOA:B9DTA4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA4"
FT                   /protein_id="CAR40724.1"
FT                   /translation="MDKKDKIKGYRTMLGKTQKEMANILNISSQSYYNKENGIVEFRDS
FT                   EKIVFKNLVKELFPNITLEDIFF"
FT   misc_feature    complement(219438..219503)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1496.000, SD 4.28 at aa 16-37, sequence
FT                   KTQKEMANILNISSQSYYNKEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             219678..220292
FT                   /transl_table=11
FT                   /locus_tag="SUB0229"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40725"
FT                   /db_xref="GOA:B9DTA5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA5"
FT                   /protein_id="CAR40725.1"
FT                   /translation="MFEKQNNKLIGSRIKNIRLEKGMTLEEFGKLFNASKSSVYGWEKG
FT                   RNLPNKERLKQIAKIGDMKLGVLLKGDKVYSPFIFPDFRNVKSEEDIKNYALECVDIIR
FT                   FSTPDMRVEELYMMFFLSISVLIEKLLRDKDLGLDSNITEIPMGEFDSLLNRDEWIALD
FT                   WFISNFFEIENFDSIYFDFKLSDFNLLRKILLKYVEISKMK"
FT   misc_feature    219717..219881
FT                   /locus_tag="SUB0229"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   6.6e-10"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    219744..219809
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1787.000, SD 5.27 at aa 23-44, sequence
FT                   MTLEEFGKLFNASKSSVYGWEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             220344..220502
FT                   /transl_table=11
FT                   /locus_tag="SUB0230"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40728"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA6"
FT                   /protein_id="CAR40728.1"
FT                   /translation="MKFFKNNTVQSLTIIALCFTLLYFHLSQNSTMFKTMIGFIFAYSV
FT                   YTFFIKD"
FT   misc_feature    order(220362..220421,220434..220493)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0230 by TMHMM2.0 at aa 7-26 and 31-50"
FT   CDS             220565..221710
FT                   /transl_table=11
FT                   /locus_tag="SUB0231"
FT                   /product="putative phage integrase"
FT                   /note="Similar to SUB1840, 49.487% identity (50.923%
FT                   ungapped) in 390 aa overlap (1-381:1-388)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40731"
FT                   /db_xref="GOA:B9DTA7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA7"
FT                   /protein_id="CAR40731.1"
FT                   /translation="MKIIEYKKKDGTIMYRSQVYLGVDRITGKKSRTSVSGRTKKELKN
FT                   NIKLAKFEFQANGETLSKKVQVKTFKDLTDMWLVNYKLTLKPQSYNSTVSMLNKHILPY
FT                   FGKMKLDKITSSDVQTFINSLSKKTINYVNARSIISRILQHGVLLQLIQHNPARDIVLP
FT                   RKQKKDSDKVKFIEKDDLKKFLDYIEKYKLRNYKTNFNYVLYKLLLATGLRIGEACALE
FT                   WSDIDLINGTINIDKTYSKSIRRLSTTKSKSGTRLISIDQATVNMLKLYQVRQRQLFHE
FT                   VGGKAPKVVFATPTRKYFHTFVRQNALDRACIEAGIPRFTFHAFRHTHASLLLNAGISY
FT                   KELQYRLGHSNIAMTLDVYSHLSKDKEKEAVSYFEKAINSI"
FT   misc_feature    221090..221671
FT                   /locus_tag="SUB0231"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 9.4e-39"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   221800..221823
FT                   /note="24mer direct repeat flanking putative phage region"
FT   CDS             221805..222275
FT                   /transl_table=11
FT                   /locus_tag="SUB0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40732"
FT                   /db_xref="InterPro:IPR021380"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTA8"
FT                   /protein_id="CAR40732.1"
FT                   /translation="MAKFGFLSVLEEEMDKHFHYDYAMDWDKKNHAVEVTFVLEAQNKA
FT                   AVETIDDQGEVSQEDIIFEDYVLFYNPEKSQFDKEDYLVAIPYEPKKGLSREFLQYFAQ
FT                   FLNDVATEGQSDLMDFLEDDSKIDFALDWDAEAFEKGKADLEEKEFFAYPRY"
FT   CDS             222293..223246
FT                   /transl_table=11
FT                   /locus_tag="SUB0233"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40734"
FT                   /db_xref="GOA:B9DTA9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTA9"
FT                   /protein_id="CAR40734.1"
FT                   /translation="MKTWQELTITVHRDAEEAVSNMLIEAGSQGVAISDSADYLGQPDR
FT                   FGEIFPDVTQDDMITITGYFPESFAITEVTASLEKQVATLKSTGLETGPVSIASHELEE
FT                   EDWAENWKKYYEPARITHDLTIVPSWTDYDAKPEEKVIKLDPGMAFGTGTHPTTKMSLF
FT                   ALEQVLRGGETVIDVGTGSGVLSIASSLLGAKEIYAYDLDDVAVRVAQENIDLNANTEN
FT                   IHVAAGDLLKGVTIQADVIVANILADILIHLTDDAYRLVKDEGYLIMSGIISEKWPMVR
FT                   ASAEKAGFFLETHMIQGEWNACVFKKTDDMSGVIGG"
FT   misc_feature    222299..223216
FT                   /locus_tag="SUB0233"
FT                   /note="HMMPfam hit to PF06325, Ribosomal protein L11
FT                   methyltransferase (Prm, score 1.1e-162"
FT                   /inference="protein motif:HMMPfam:PF06325"
FT   CDS             223246..223989
FT                   /transl_table=11
FT                   /locus_tag="SUB0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40735"
FT                   /db_xref="GOA:B9DTB0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB0"
FT                   /protein_id="CAR40735.1"
FT                   /translation="MQQYFMNSQAQSQFQVTDRETLKHMFQVMRLSEDDHVVIVFSDHR
FT                   KRLAKVLDSQNHLFEIVEELDDNVELPVQVTIASGFPKADKLDLVTQKATELGAHAIWS
FT                   FPADWSVVKWDGKKLAKKAEKLEKIALGAAEQSKRNLVPEVVLFERKVDFLAELSHFDK
FT                   IFIAYEESAKDGEKAALAKALSSLKKGDKILFIFGPEGGISPKEIALFEGAGAIKVGLG
FT                   PRIMRTETAPLYALSAVSYALELNA"
FT   misc_feature    223624..223965
FT                   /locus_tag="SUB0234"
FT                   /note="HMMPfam hit to PF04452, Protein of unknown function
FT                   (DUF558), score 8.6e-54"
FT                   /inference="protein motif:HMMPfam:PF04452"
FT   CDS             224085..225089
FT                   /transl_table=11
FT                   /locus_tag="SUB0235"
FT                   /product="LacI family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40736"
FT                   /db_xref="GOA:B9DTB1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB1"
FT                   /protein_id="CAR40736.1"
FT                   /translation="MVTIKDVARLAGVSPSTASRAMHDNEMISQATRDKVKKVMEELNY
FT                   SPNYSAQNLVKRQSNTVGIILPVRESQEALGDNPFFMQIIQGISGICTKEGQMVSLATG
FT                   QKEEDLLKNVQNMIRSGNVRKFIFLYSKTDDPVFDFMRKEKVRCVVVGQPYDQSQKQAY
FT                   FVNNHNQEAGKDATNFLLDKGYQAISYVYTDMDELVQAERYMGYAEAMKIRNHQAQSLN
FT                   VSLVDHEASKKQLLQHLEQRDAQAFVTSDDMLGIHLQRLLKEIGQENKAIISFNNSVLA
FT                   QLANPALTSVDIFPYLLGERAASVLLKTHQAKDAIDIIPHKIIERESTPNFLI"
FT   misc_feature    224088..224165
FT                   /locus_tag="SUB0235"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 8.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    224088..224153
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2103.000, SD 6.35 at aa 2-23, sequence
FT                   VTIKDVARLAGVSPSTASRAMH"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    224094..224150
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    224259..225065
FT                   /locus_tag="SUB0235"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 8.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   CDS             225227..227410
FT                   /transl_table=11
FT                   /locus_tag="SUB0236"
FT                   /product="putative glucose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40738"
FT                   /db_xref="GOA:B9DTB2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB2"
FT                   /protein_id="CAR40738.1"
FT                   /translation="MKASFKQFFSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPMIN
FT                   PDSAVLTTIGHVTAEIGWAVIGNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRITG
FT                   AVYGINAAMLADPDAKIKSFLGTEMVVKNYFTSVLESPALNTGVFVGIIAGFVGATAYN
FT                   KYYNYRKLPEVLTFFNGKRFVPFVVILRSTVVALLLALIWPVIQSGINGFGMWIASSQD
FT                   TAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGAGAGTKVFGQDPLWL
FT                   AWVTDLVGLKGAGKTEAYHHLMATVTPARFKVGQMIGATGTLMGIALAMYRNVDADKKG
FT                   KYKMMFISAAAAVFLTGVTEPLEYMFMFAAMPLYVVYALVQGASFAMADLVHLRVHSFG
FT                   NIELLTRTPMAIKAGLGMDLVNFVWVSLLFAAIMYVIADFMIKKMNLATAGRLGNYDAD
FT                   MLDDVAPAEAGKVADGNSQTVQIINLLGGRENISDVDACMTRLRVTVKDANQVGSEDLW
FT                   KKAGAMGLIVKGNGVQAVYGPKADILKSDIQDLLDSGASIPVSDFTKSEKVVARSVFKG
FT                   IKEDILSVADGRVMPITDVNDQVFAGKMMGDGFAVEPDSGNIYAPVSGVLTSVFPTKHA
FT                   FGILTDNGLEVLVHVGLDTVALNGVPFSLKVSEGQRVEAGDLLVVADLAAIKSADRETT
FT                   IVVAFTNQTEIESVVLDVRGQQAAKTKVATVTL"
FT   sig_peptide     225227..225370
FT                   /locus_tag="SUB0236"
FT                   /note="Signal peptide predicted for SUB0236 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.873) with cleavage site
FT                   probability 0.340 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    225278..226372
FT                   /locus_tag="SUB0236"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.2e-43"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    order(225287..225355,225398..225466,225485..225553,
FT                   225647..225715,225776..225844,226163..226216,
FT                   226250..226303,226316..226384,226481..226549)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0236 by TMHMM2.0 at aa 21-43, 58-80, 87-109, 141-163,
FT                   184-206, 313-330, 342-359, 364-386 and 419-441"
FT   misc_feature    226091..226114
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    226658..226762
FT                   /locus_tag="SUB0236"
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 1.1e-15"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    226694..226747
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    227015..227329
FT                   /locus_tag="SUB0236"
FT                   /note="HMMPfam hit to PF00358,
FT                   phosphoenolpyruvate-dependent sugar phosph, score 1.3e-50"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    227153..227191
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS             227492..228313
FT                   /transl_table=11
FT                   /locus_tag="SUB0237"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40741"
FT                   /db_xref="GOA:B9DTB3"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB3"
FT                   /protein_id="CAR40741.1"
FT                   /translation="MAKFLTLNTHSWMEANALKKLVDLAEHILAEKYDVICLQEINQLI
FT                   NSELAEEDFFYRPIPGTPALHKDNFALLLVNYLQKRGQHYYWSWAYNHIGYDIYHEGVA
FT                   IFSKKPITATDILMSQVDDEHDYHTRRALLAKTEIDGKETALVSLHMSWFGKGFEGEWT
FT                   TLETELNALGIPLMIMGDFNNPTDLEGYQLIEASPLGLRDSHKVADKVFGDYSIVADID
FT                   GWKDNKESYKVDHAFASKEFDILRSEITFEGGSAPVISDHFGLEVTTKWKS"
FT   misc_feature    227495..228298
FT                   /locus_tag="SUB0237"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 2.6e-11"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS             complement(228403..228900)
FT                   /transl_table=11
FT                   /locus_tag="SUB0238"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40743"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB4"
FT                   /protein_id="CAR40743.1"
FT                   /translation="MTEPIIIPKNKLGNLFYAVMSFLFVFFGFFMCLIPDILIQFIGVI
FT                   TILFFGLCFITFLKRIVNKTPILLINDLGVYDHSTAIAIGFIPWQDIEAIQLTSLFNQT
FT                   FISISVKDQQSYLKKMTVLQRLTTKANLKMGYPLINITLNTTGQKPEKVMEEIERQFGG
FT                   YY"
FT   misc_feature    complement(order(228727..228786,228799..228867))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0238 by TMHMM2.0 at aa 12-34 and 39-58"
FT   CDS             complement(228936..229997)
FT                   /transl_table=11
FT                   /locus_tag="SUB0239"
FT                   /product="M42 gutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40746"
FT                   /db_xref="GOA:B9DTB5"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB5"
FT                   /protein_id="CAR40746.1"
FT                   /translation="MMMKRGNLVKTTVDYITTLTQIPSPTGFTKTIMDYLTSELSSFGY
FT                   EPVRTHKGGLMVSVKGKDDSKHRVVTAHLDTLGAMVRAIKPDGRLKMDLVGGFVYNAIE
FT                   GENCTVHVAKNGREISGTILIHQTSVHVYKDAGTAERNQANMEVRLDEKVRTADETRAL
FT                   GIEVGDFISFDPRVVVTESGFIKSRHLDDKVSAAILIELLKDYKENKVILPYTTHFYFS
FT                   AFEEVGHGANSSLPKEAVEYLAVDMGAMGDDQATDEYTVSICVKDASGPYHYELRQHMV
FT                   ALCQSNNIPYKLDIYPFYGSDASAAIRSGAEVKHALLGAGIESSHSYERTHRDSVEATE
FT                   KLVDAYLKSQMID"
FT   misc_feature    complement(228972..229841)
FT                   /locus_tag="SUB0239"
FT                   /note="HMMPfam hit to PF05343, M42 glutamyl aminopeptidase,
FT                   score 9.5e-121"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   CDS             complement(230044..230520)
FT                   /transl_table=11
FT                   /locus_tag="SUB0240"
FT                   /product="putative NrdI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40748"
FT                   /db_xref="GOA:B9DTB6"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB6"
FT                   /protein_id="CAR40748.1"
FT                   /translation="MSTVTVVFISLSGNTLSFVKRLSQHLKEGYDIETKTINIKELNHQ
FT                   TFAVEEAFVAILPTYLEGGNGLDSGDIEILTNPLGDFIAAHDNYKRCFGIIGSGNRNFN
FT                   NQYCLTAKQYAKRFGFPMIGDFELRGTISDIERLAKIIVAEKEAFLKDSIIKIV"
FT   CDS             complement(230655..233111)
FT                   /transl_table=11
FT                   /locus_tag="SUB0241"
FT                   /product="putative surface-anchored 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase"
FT                   /note="Internal region is similar to Escherichia coli
FT                   2',3'-cyclic-nucleotide 2'-phosphodiesterase precursor CpdB
FT                   UniProt:CN16_ECOLI (EMBL:ECCPDB) (647 aa) fasta scores:
FT                   E()=5.6e-90, 46.809% id in 611 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40749"
FT                   /db_xref="GOA:B9DTB7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB7"
FT                   /protein_id="CAR40749.1"
FT                   /translation="MRKHYVSKSAIFLAMLVATGSAQFVKAETPTTTTSPATSLTDASA
FT                   STTPTTNTTSTVTPALDPNTNFTVDSSATTSTTTPSPVEAAAISPVIATAQPTTNVTSA
FT                   SLAPAANTMATTPVEGQTVDVRIISTTDLHSNLVNYDYYQDKASQTIGLAKAAVLIDQA
FT                   KAENPNAVLVDNGDILQGTPLGTYEALIDPLQPGEVHPMYAALDKLGFDASTLGNHEFN
FT                   YGLTFIENAIASAGLPILNANVFDAATGEYLFQPYAIVTKSFTDANGQAVDLKIGITGI
FT                   VPPQIMLWDKANLEGKVTVKDAVQAVTEIIPTIKNAGADIVLVLAHTGIGDDVYETGEE
FT                   NVGYQIASLAGVDAVVTGHSHAEFPSGQDTGFYESYNGVDGVSGLINGTPVTMAGKYGD
FT                   HIGIIDLNVSYTGGKWTVNRDKNHAEIRKIDTKSTIADADILALAQASHLGTIDYVRQT
FT                   VGETTAPINSYFALVKDDPSVQIVNNAQLWYAKQQLAGTPEADLPLLSAAAPFKAGTRN
FT                   DPTAYTDIPAGPIAIKNVADLYLYDNVTAILKLTGADIKEWLEMSAGQFNTIDPNVAGP
FT                   QNLVNTDYRTYNFDVIDGVTYEFDVTQPNKYDAKGNLLNPNASRVRNLKFQGKEIDPNQ
FT                   EFMVVTNNYRASGSFPGVKNATINRLLNLENRQAIINYIVSEKTINPSADNNWYFADTI
FT                   QGLDLHFLSADTSKNLIGDKADISYTGPSTIEGFGDFVFTYVKPELPVATPETPQETGS
FT                   QLTENRRQEIHQLATRVYNQTKATSSSTTKAELPKAGSQESKGLFFMGLSLLGLAGLIT
FT                   KKEERQ"
FT   misc_feature    complement(230661..230780)
FT                   /locus_tag="SUB0241"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   0.0017"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   misc_feature    complement(231147..231740)
FT                   /locus_tag="SUB0241"
FT                   /note="HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal
FT                   domain, score 7.3e-64"
FT                   /inference="protein motif:HMMPfam:PF02872"
FT   misc_feature    complement(232023..232739)
FT                   /locus_tag="SUB0241"
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 1.6e-14"
FT                   /inference="protein motif:HMMPfam:PF00149"
FT   misc_feature    complement(232446..232481)
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT                   /inference="protein motif:Prosite:PS00786"
FT   sig_peptide     complement(233031..233111)
FT                   /locus_tag="SUB0241"
FT                   /note="Signal peptide predicted for SUB0241 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.768 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             233359..235578
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="SUB0242"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40752"
FT                   /db_xref="GOA:B9DTB8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTB8"
FT                   /protein_id="CAR40752.1"
FT                   /translation="MAKEKNLSGEEVVSIAASYMNKKDIAFVKKALDYATTAHFYQARK
FT                   SGEPYIIHPIQVAGILADLHLDATTVACGFLHDVVEDTEISLDDIEAEFDKDVRDIVDG
FT                   VTKLGKVEYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERI
FT                   SRETMEIYAPLAHRLGISRIKWELEDLAFRYLNESEFYKISHMMREKRREREALVDEIV
FT                   AKIVTYTNEQGLYGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAM
FT                   VGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVA
FT                   AHWAYKKGVKGKVNQTDQKVGMNWIKDLVELQDASNGDAKDFVDSVKEDIFSERIYVFT
FT                   PNGAVQELPKDSGPIDFAYAIHTQVGEKATGAKVNGKMVPLTSKLKTGDVVEIVTNPNS
FT                   FGPSRDWIKIVKTNKARNKIRQFFKNQDKELSVNKGRELLVNFFQEQGYVANKYLDRKR
FT                   IEEILPRVSVKSVESLYAAVGFGDLSPVSIFNKLTEKERREEERAKAKAEAEELVKGGE
FT                   VKHENKEVLKVRSENGVIIQGASGLLMRIAKCCNPVPGDPIEGYITKGRGIAIHRSDCN
FT                   NIKSQDGYEQRLIEVEWDLENSSKDYQAEIDIYGLNRTGLLNDVLQILSNSTKTITTVN
FT                   AQPTKDMKFANIHVSFGIANLASLLTVVEKIKAVPDIYNVKRTNG"
FT   misc_feature    233506..233805
FT                   /gene="relA"
FT                   /locus_tag="SUB0242"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   misc_feature    234076..234405
FT                   /gene="relA"
FT                   /locus_tag="SUB0242"
FT                   /note="HMMPfam hit to PF04607, Region found in RelA / SpoT
FT                   proteins, score 5.4e-48"
FT                   /inference="protein motif:HMMPfam:PF04607"
FT   misc_feature    234529..234720
FT                   /gene="relA"
FT                   /locus_tag="SUB0242"
FT                   /note="HMMPfam hit to PF02824, TGS domain, score 6.5e-31"
FT                   /inference="protein motif:HMMPfam:PF02824"
FT   misc_feature    235345..235569
FT                   /gene="relA"
FT                   /locus_tag="SUB0242"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 2.2e-05"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS             235590..236033
FT                   /transl_table=11
FT                   /locus_tag="SUB0243"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40754"
FT                   /db_xref="GOA:B9DTB9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTB9"
FT                   /protein_id="CAR40754.1"
FT                   /translation="MKIVIQRVSEASVAIEGEIVGAIQKGLLLLVGFGPEDGQEDVDYA
FT                   VRKITQMRIFSDAEDKMNLSLLDIKGSILSISQFTLFANTKKGNRPAFTEAAKPEMASQ
FT                   LYEQFNQALSAFCPLERGVFGADMKVSLVNDGPVTIILDTKNR"
FT   misc_feature    235671..236021
FT                   /locus_tag="SUB0243"
FT                   /note="HMMPfam hit to PF02580, D-Tyr-tRNA(Tyr) deacylase,
FT                   score 5.9e-74"
FT                   /inference="protein motif:HMMPfam:PF02580"
FT   CDS             236123..236971
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="SUB0244"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40755"
FT                   /db_xref="GOA:B9DTC0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC0"
FT                   /protein_id="CAR40755.1"
FT                   /translation="MDIKTIFPEVRVSSGPANEEEWVSIEDGDQFLLFPKEQLSSRELA
FT                   LLEFYLSPVKKSSKKRTAWEKYLLEDGAELPERLEEGQFIYLSHQLPIPSEMVELLESI
FT                   FGQPKAILSLSQTQTVFLLTRSDSFGQIALIKDILPTLENDFGLALRLFIGNHWSSLTA
FT                   NQLRDYFLEEGALYDAYRTQNSDETLILYSKILLWALNADHIPKAICHYYQMVLGNQKE
FT                   TRELVEALWDSHGNLVQTAQSLYIHRNSLQYKLDKVYRQTGLQLKQLDDLAFAYLFLQK
FT                   S"
FT   CDS             237073..238206
FT                   /transl_table=11
FT                   /gene="msmK"
FT                   /locus_tag="SUB0245"
FT                   /product="multiple sugar-binding transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40756"
FT                   /db_xref="GOA:B9DTC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC1"
FT                   /protein_id="CAR40756.1"
FT                   /translation="MVELNLNHIYKKYPNTSHYAVEDFDLDIKDKEFIVFVGPSGCGKS
FT                   TTLRMIAGLEDISEGELKIDGEVVNDKSPKDRDIAMVFQNYALYPHMTVYDNMAFGLKL
FT                   RKYKKADIDQRVKEAAQILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPL
FT                   SNLDAKLRVSMRAEIAKIHRRIGSTTIYVTHDQTEAMTLADRIVIMSATKNPEGNGTIG
FT                   KIEQVGSPQELYNQPANKFVAGFIGSPAMNFFDVTVEGTRIVSEDGLDIAITEGQAKML
FT                   KEAGYDGKKVTFGIRPEDISANLLVEETFPKANVEAEVLVSELLGSETMLYVKLGQTEF
FT                   ASRVDARDFHNPGEKVSLTFNVSKGHFFDLETEKAIR"
FT   misc_feature    237163..237708
FT                   /gene="msmK"
FT                   /locus_tag="SUB0245"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.5e-61"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    237184..237207
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    237478..237522
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    238000..238173
FT                   /gene="msmK"
FT                   /locus_tag="SUB0245"
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 2.8e-09"
FT                   /inference="protein motif:HMMPfam:PF03459"
FT   CDS             238299..239906
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="SUB0246"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /EC_number="3.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40758"
FT                   /db_xref="GOA:B9DTC2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC2"
FT                   /protein_id="CAR40758.1"
FT                   /translation="MKKHWWHQATIYQIYPRSFQDTSGNGIGDLKGITQHLDYLQNLGI
FT                   TAIWLSPVYQSPMDDNGYDISDYQAIADIFGDMADMDHLLSEAKKRDIKIIMDLVVNHT
FT                   SDEHAWFVEARENPQSPERDFYIWRDQPNDLMSTFSGSAWQQDPASGQYYLHLFSKKQP
FT                   DLNWENPDLRHKIYEMMNFWIAKGIGGFRMDVIDLIGKIPDLEITGNGPKLHDYLKEMN
FT                   QATFGKHDLLTVGETWGATPEIAKQYSCPENKELSMVFQFEHIGLQHKPNRPKWDFVDE
FT                   LDVPALKRIFSKWQTELELGQGWNSLFWNNHDLPRVLSIWGNDQEHRQKSGKALAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFDTLEQVDDIESVNYAKEALANGVSEVAIMESIRRIGRD
FT                   NARTPMQWDDSLHAGFTSADKPWLAVNPNYKEINVAKALADKESLFYTYQKLITLRKEQ
FT                   DWLVDADFNLLETADKIFAYERRLEKETYLIVVNLSNQTQDFEGLPAHYQTVISNTDLN
FT                   HIEKTGQLAAWDAFCIKK"
FT   misc_feature    238335..239504
FT                   /gene="dexB"
FT                   /locus_tag="SUB0246"
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 8.5e-130"
FT                   /inference="protein motif:HMMPfam:PF00128"
FT   CDS             240022..240687
FT                   /transl_table=11
FT                   /locus_tag="SUB0247"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40759"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC3"
FT                   /protein_id="CAR40759.1"
FT                   /translation="MINKKIIFTSLTVICISNCNIVSAEDKVSNESYFPSNQIEKWERD
FT                   ILEKADRDIPVGDIKANDGKIFRSSTGLWSWRDGIICITDSHAKSSLFNNGHAGIVAAA
FT                   PYYDATIEANPNDGVQPKYGKWDERFGGSKVYQYGVTKTSVIQDQNAAIWAAKQINKPY
FT                   NHNFFDIGRRDRFYCSQLVWAAYKDISGIDIGTWEWGHAIHPFELMNSKETTLLYRNK"
FT   sig_peptide     240022..240093
FT                   /locus_tag="SUB0247"
FT                   /note="Signal peptide predicted for SUB0247 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.994 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             240690..241763
FT                   /transl_table=11
FT                   /locus_tag="SUB0248"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40760"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC4"
FT                   /protein_id="CAR40760.1"
FT                   /translation="MMSKIVKKIFFLTAFLIMFFLSACAAKQAKKEFQLAVFDKKTVHT
FT                   FKFSGNQVVPVEKLSRKGNMSFARESFKSAGQRYVTKTLEGDGLTVYLESIDGKTLEET
FT                   IQPALGNDAYTSTTDGNYFYATAVFTDRIDCYKYDLQMKKILKKSIPNNEVINASNQFL
FT                   VIDNSLYLLVSYVDKSTQQPGTCLWKMNKDFNIQEIIDLNDSSAYLRMANVGEVLYIPE
FT                   SYKGSDSNGEPKTGKQIMVFDLVKREKRYLPTSAKYPKSIVYNQESESIIIENDGAFTK
FT                   TFSWTIHNLQTGQEKLLTLPVSYRRGYLPPFVSYQKNRIYFLFSDYLIQYDILSEKIVT
FT                   IDLKKYHIHNAHAMILK"
FT   sig_peptide     240690..240764
FT                   /locus_tag="SUB0248"
FT                   /note="Signal peptide predicted for SUB0248 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.795 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    240714..240767
FT                   /note="1 probable transmembrane helix predicted for SUB0248
FT                   by TMHMM2.0 at aa 9-26"
FT   misc_feature    240729..240761
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             join(242062..242112,242142..243086)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="SUB0249"
FT                   /product="UDP-glucose 4-epimerase (pseudogene)"
FT                   /EC_number="5.1.3.2"
FT                   /note="Similar to Streptococcus mutans UDP-glucose
FT                   4-epimerase GalE UniProt:GALE_STRMU (EMBL:AE014930) (333
FT                   aa) fasta scores: E()=1e-97, 77.341% id in 331 aa. CDS
FT                   contains a frameshift after codon 17. Frameshift occurs at
FT                   a direct repeat region (29mer)"
FT                   /db_xref="PSEUDO:CAR40762.1"
FT   repeat_region   242079..242143
FT                   /note="Direct repeat"
FT   misc_feature    242136..243065
FT                   /gene="galE"
FT                   /locus_tag="SUB0249"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 9e-139"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS             243153..243509
FT                   /transl_table=11
FT                   /locus_tag="SUB0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40765"
FT                   /db_xref="GOA:B9DTC6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC6"
FT                   /protein_id="CAR40765.1"
FT                   /translation="MDFQEAVSGFEEISISTLEQKLNSEDTIIVFFGRSTCPYCRRFAP
FT                   KLAQVAQEKALQVYFIDTDNLVDFEDIQDFRYQYGIKTVPGLLVGNTESVEVVCDSSLS
FT                   PTEIATFILGGAEK"
FT   CDS             243585..243968
FT                   /transl_table=11
FT                   /locus_tag="SUB0251"
FT                   /product="putative preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40766"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC7"
FT                   /protein_id="CAR40766.1"
FT                   /translation="MGLSTILMFVVMLGLIFFMQRQQKKQAQERQNQLNAIQKGDEVVT
FT                   IGGMYAIVDEVDTVGNKIVLDVDGVFLPFELSAIKRVVSKGDHYPEAAVVAESETVVEP
FT                   ESEVVEESAIDSHDSNDSAIESH"
FT   misc_feature    243585..243833
FT                   /locus_tag="SUB0251"
FT                   /note="HMMPfam hit to PF02699, Preprotein translocase
FT                   subunit, score 8.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02699"
FT   misc_feature    243597..243641
FT                   /note="1 probable transmembrane helix predicted for SUB0251
FT                   by TMHMM2.0 at aa 5-19"
FT   CDS             244132..244881
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SUB0252"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40767"
FT                   /db_xref="GOA:B9DTC8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC8"
FT                   /protein_id="CAR40767.1"
FT                   /translation="MLRFKMKSKEETIEKIPKHIGIIMDGNGRWAKKRLKPRVFGHKAG
FT                   MDALQEVTIAASQYGVKVLTVYAFSTENWSRPQDEVSFIMNLPVEFFDKYVPELNKNNV
FT                   RIQMIGETHRLPEATLSALNRAIEATRKNSGLVLNFALNYGGRAEITNAVKLIAQDVLD
FT                   ANLNPGDITEDLIANYLLTDHLPYLYRDPDFIIRTSGELRLSNFLPWQSAYSELYFTPI
FT                   LWPDFKKTAFEEALREYNRRHRRFGGL"
FT   misc_feature    244198..244875
FT                   /gene="uppS"
FT                   /locus_tag="SUB0252"
FT                   /note="HMMPfam hit to PF01255, Putative undecaprenyl
FT                   diphosphate syntha, score 2.3e-106"
FT                   /inference="protein motif:HMMPfam:PF01255"
FT   misc_feature    244708..244761
FT                   /note="PS01066 Undecaprenyl pyrophosphate synthetase family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01066"
FT   CDS             244893..245687
FT                   /transl_table=11
FT                   /locus_tag="SUB0253"
FT                   /product="putative phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40768"
FT                   /db_xref="GOA:B9DTC9"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTC9"
FT                   /protein_id="CAR40768.1"
FT                   /translation="MKERVIWGGIAAAIFLPFLLIGNLPFQLFIGILAMLAVSELMKMR
FT                   RLEIFSFEGVLAMLAAFVLTVPMDTYLTFLPIDASFASFGLMVFLLLAGTVFNSERYSF
FT                   DDAAFPIASSLYVGIGFQNLVHARVSGIDKVLLALFIVWATDMGAYFIGRRFGKRKLLA
FT                   KVSPNKTIEGSLGGIASAVVVAMVFMLIDKSVYAPFNFFMMLILVVFFSIFAQFGDLVE
FT                   SAIKRHFGVKDSGKLIPGHGGILDRFDSLIFVFPIMHLFGLF"
FT   misc_feature    244896..245684
FT                   /locus_tag="SUB0253"
FT                   /note="HMMPfam hit to PF01148, Cytidylyltransferase family,
FT                   score 1.4e-97"
FT                   /inference="protein motif:HMMPfam:PF01148"
FT   misc_feature    order(244935..245003,245037..245096,245106..245174,
FT                   245211..245267,245295..245348,245409..245465,
FT                   245475..245543)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SUB0253 by TMHMM2.0 at aa 15-37, 49-68, 72-94, 107-125,
FT                   135-152, 173-191 and 195-217"
FT   misc_feature    245559..245639
FT                   /note="PS01315 Phosphatidate cytidylyltransferase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01315"
FT   CDS             245722..246981
FT                   /transl_table=11
FT                   /gene="eep"
FT                   /locus_tag="SUB0254"
FT                   /product="putative pheromone-processing membrane
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40770"
FT                   /db_xref="GOA:B9DTD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD0"
FT                   /protein_id="CAR40770.1"
FT                   /translation="MLGLITFIIVFGILVIVHEFGHFYFAKKSGILVREFAIGMGPKLY
FT                   SHVDKEGTLYTIRSLPLGGYVRMAGWGDDSTEIKTGTPASLSLDASGKVTRINLSQNRL
FT                   DPNSLPMHVTAYDLEDKLTITGLVLEETKEFDVAHDATIVEEDGTEVRIAPLDVQYQNA
FT                   SIWGRLITNFAGPMNNFILGLLVFIFLVFLQGGALDTNSNHIKVVDNGAAAKAGIKSND
FT                   QILQIENIPVSNWQELTGAVASSTKDLKEGQSLTVKVKSQGKVKELSLKPQKVGGKFAI
FT                   GVQCRLKTGFKDKLLGGFEMAINGALLIITALKNLMTGFSLDKLGGPVAMYQMSSQAAA
FT                   SGIETVLSMMAMLSINLGIFNLIPIPALDGGKILMNLIEAIRRKPLKRETETYITFVGV
FT                   VIMLVLMVAVTWNDIMRAFF"
FT   misc_feature    order(245731..245799,246226..246294,246619..246687,
FT                   246748..246816,246895..246954)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0254 by TMHMM2.0 at aa 4-26, 169-191, 300-322, 343-365
FT                   and 392-411"
FT   misc_feature    245737..246960
FT                   /gene="eep"
FT                   /locus_tag="SUB0254"
FT                   /note="HMMPfam hit to PF02163, Peptidase family M50, score
FT                   2.4e-80"
FT                   /inference="protein motif:HMMPfam:PF02163"
FT   misc_feature    245764..245793
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS             247004..248860
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /gene_synonym="drpA"
FT                   /locus_tag="SUB0255"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40772"
FT                   /db_xref="GOA:B9DTD1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTD1"
FT                   /protein_id="CAR40772.1"
FT                   /translation="MKQSKMLIPTLREMPSDAQVISHALMMRAGYVRQVSAGIYAYLPL
FT                   ANRTIEKLKTIMRQEFDKIGAVEMLAPALLTADLWRESGRYETYGDDLYKLKNRESSDF
FT                   ILGPTHEETFTTLVRDAVKSYKQLPLNLYQIQAKYRDEKRPRNGLLRTREFIMKDGYSF
FT                   HQNYEDLDVTYEDYRKAYEAIFTRSGLEFKGIIGDGGAMGGKDSQEFMAITPERTDLNR
FT                   WLVLDKSIPSLSDIPEDVLEEIKKELASWLISGEDTIAYSSESSYAANLEMASNAFSPT
FT                   TKVAVAEDLKEVATPDCKTIDQVADFLNISAETTIKTLLFIADEKPVVALLVGNDQVND
FT                   VKLKNYLGADFLDPATEEEAFQVFGAHFGSLGPVNLPDSVRIIADRNVQNLANAVSGAN
FT                   KDGFHLTGVNPERDFKAEFVDIREVKEGEASPDGHGHLQFARGIEVGHIFKLGTRYSDS
FT                   LGANILDENGKSIPIVMGCYGIGVSRILSAVIEQHARLFVSKTPKGEYRYSWGINFPKE
FT                   LAPFDIHLITVNTKDEEAQTLTDKLEKELMTKGYEVLTDDRNERVGSKFSDSDLIGLPI
FT                   RITVGKKASEGIVEIKIKASGDSIEVNAENVIETLEILTKDH"
FT   misc_feature    247115..247579
FT                   /gene="proS"
FT                   /gene_synonym="drpA"
FT                   /locus_tag="SUB0255"
FT                   /note="HMMPfam hit to PF00587, tRNA synthetase class II
FT                   core domain (, score 1.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    247418..247480
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    247868..248266
FT                   /gene="proS"
FT                   /gene_synonym="drpA"
FT                   /locus_tag="SUB0255"
FT                   /note="HMMPfam hit to PF04073, YbaK / prolyl-tRNA
FT                   synthetases associa, score 2.6e-31"
FT                   /inference="protein motif:HMMPfam:PF04073"
FT   misc_feature    248567..248845
FT                   /gene="proS"
FT                   /gene_synonym="drpA"
FT                   /locus_tag="SUB0255"
FT                   /note="HMMPfam hit to PF03129, Anticodon binding domain,
FT                   score 1.1e-17"
FT                   /inference="protein motif:HMMPfam:PF03129"
FT   CDS             248939..249496
FT                   /transl_table=11
FT                   /locus_tag="SUB0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40774"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD2"
FT                   /protein_id="CAR40774.1"
FT                   /translation="MTKNDLKLLLRENKELMEILGIVQELSLKDSWVAAGAVRNVIWNA
FT                   LSGKAGFDWDSDVDLVFFDPNMTYGDSLKIEEELNKRYPIYQWQVRNQVHMHRHNPKTA
FT                   PYLSACDAISKYPETFTSIALRLQGDELDLFAPYGIEAILTFECHPTPYFLENPERMAI
FT                   YRKRFSQKNWRQKWPHLTFFED"
FT   misc_feature    248996..249490
FT                   /locus_tag="SUB0256"
FT                   /note="HMMPfam hit to PF06042, Bacterial protein of unknown
FT                   function (DUF92, score 5.2e-68"
FT                   /inference="protein motif:HMMPfam:PF06042"
FT   CDS             249625..254022
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /product="DNA polymerase III PolC-type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40776"
FT                   /db_xref="GOA:B9DTD3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD3"
FT                   /protein_id="CAR40776.1"
FT                   /translation="MSDLFVKLMEQIEMPLEMRTSSAFSTADIIEVKVHSVSRLWEFHF
FT                   QMAEILPIAIYKELDYRLKTTFEQADIKAVFDIKAESVDYSDDLLQAYYQEAFEHAPCN
FT                   GASFKSTFSKLKVRYEDGKLQIATPQFVNNDHFRKNHIPNLAKQMEAFGFSLIEIEMVP
FT                   DEEMTQVLKENFTTSRKALLEKAVQETLEAQKSLEAMQPPAEEVTSKPVFDYKERVAQR
FT                   QAGFEKAEITPMIEIETEENRIVFEGLVFDVERKTTRTGRHIINFKMTDYTSSFAMQKW
FT                   AKDDDELRKYDLVAKGAWLRVQGNIENNPFTKSLTMNVQQIKEIVHHERKDLMPEGQKR
FT                   VELHAHTNMSTMDALPTVETLIDTAAKWGHPAIAITDHANVQSFPHGYHRARKAGIKAI
FT                   FGLEANIVEDKVPISYQPVSMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMYKGNII
FT                   EQFDEFIDPGHPLSAFTTELTGITDNHLIGAKPLLQVLEEFQAFCHDTVLVAHNASFDI
FT                   GFMNANYERNGLPQITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLEHHHMANYDA
FT                   EATGRLLFIFLKEAREKHGVTDLLDLNIKLVAEDSYKKARIKHATIYVQNQTGLKNIFK
FT                   LVSLSNVKYFEGVPRIPRTVLDQYRDGLLLGSACSEGEVFDAVLTKGVEAATEVAKYYD
FT                   FIEIMPPAIYQPLIAKELIKDQEGVQQTILDLIEVGRRLNKPVIATGNVHYIEPEDEIY
FT                   REIIVRSLGQGAMINRPIGRGEAAQPAPLPKAHFRTTNEMLDEFAFLGKDLAYQVVVQN
FT                   SQDFADLIEEVEVVKGDLYTPFIEKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELT
FT                   SILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPN
FT                   CQHSEFITDGSVGSGYDLPNKNCPQCGSPYQKDGQDIPFETFLGFDGDKVPDIDLNFSG
FT                   DDQPNAHLDVRDIFGEEYAFRAGTVGTVAEKTAYGFVKGFERDYGKYYRDAEVDRLAAG
FT                   AAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPAEDVTASWQTTHFNFHDIDENVLKLD
FT                   ILGHDDPTMIRKLQDLSGIDPKSIPADDPGVMALFSGTDILGVTPEQIGTPTGMLGIPE
FT                   FGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDI
FT                   MVYLMHAGLEPKMAFTIMERVRKGMWLKISEDERNSYIQAMRENNVPDWYIESCGKIKY
FT                   MFPKAHAAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKSRMEEI
FT                   ALKKKNNEASNVENDLYTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIEGDTLIPPFVA
FT                   LEGLGENVAKQIVKARQDGEFLSKMELRKRGGASQTLVEKMDDMGILGNLPEDNQLSLF
FT                   DDFF"
FT   misc_feature    250354..250599
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    250645..250842
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /note="HMMPfam hit to PF02231, PHP domain N-terminal
FT                   region, score 3e-28"
FT                   /inference="protein motif:HMMPfam:PF02231"
FT   misc_feature    250903..251373
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, score 9.7e-38"
FT                   /inference="protein motif:HMMPfam:PF00929"
FT   misc_feature    251467..251880
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /note="HMMPfam hit to PF02811, PHP domain C-terminal
FT                   region, score 2.5e-19"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   misc_feature    251977..253434
FT                   /gene="polC"
FT                   /locus_tag="SUB0257"
FT                   /note="HMMPfam hit to PF07733, Bacterial DNA polymerase III
FT                   alpha sub, score 1.5e-191"
FT                   /inference="protein motif:HMMPfam:PF07733"
FT   CDS             254102..254527
FT                   /transl_table=11
FT                   /locus_tag="SUB0258"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40778"
FT                   /db_xref="GOA:B9DTD4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD4"
FT                   /protein_id="CAR40778.1"
FT                   /translation="MGEFKNAAVKSMVVMRKAFRTIDAKVSESYKEFELTPTQFAVLDV
FT                   LYAKGTLKIGELINSMLATSGNMTVVIKNMEKKGWVERIMCPNDKRSFLVSLTEEGERV
FT                   IKEALPKHIERVEETFSVLTETEQEELIRLLKKFKQS"
FT   misc_feature    254204..254515
FT                   /locus_tag="SUB0258"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.6e-35"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   CDS             254717..255292
FT                   /transl_table=11
FT                   /locus_tag="SUB0259"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40780"
FT                   /db_xref="GOA:B9DTD5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD5"
FT                   /protein_id="CAR40780.1"
FT                   /translation="MFKGEKEMKNILFIDGSLRKGSFNHQLAEEAEKAFAGKATVSYLD
FT                   WAQVPVFSQDLEANAPESVVKVREAIQAADAIWIFSPVYNFSIPGSVKNLLDWVSRALD
FT                   LSDPTGPSAINGKVVTVSSVANGGHDQMFAIYNDLIPFIRTTSAGEFTKATVNPEAWGT
FT                   GVLEISDETKASLAAQAEALLAAVSTEA"
FT   misc_feature    254738..255283
FT                   /locus_tag="SUB0259"
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 2.7e-15"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   CDS             complement(255341..255955)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SUB0260"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40782"
FT                   /db_xref="GOA:B9DTD6"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTD6"
FT                   /protein_id="CAR40782.1"
FT                   /translation="MSAQDKIIKASHLITMDDIIREGNPTLRKEASEVSLPLSDEDIIL
FT                   GEKMMQFLKHSQDPVMAEKLGLRGGVGLAAPQLDISKRIIAVLVPNMEDSEGNPPKEAY
FT                   SLQEIMYNPKIVAHSVQEAALADGEGCLSVDRLVEGYVVRHSRVTVDYYDKKGDKHRIK
FT                   LKGYNAIVVQHEIDHINGIMFYDRINSQNPFAIKEGMLIIE"
FT   misc_feature    complement(255374..255910)
FT                   /gene="def"
FT                   /locus_tag="SUB0260"
FT                   /note="HMMPfam hit to PF01327, Polypeptide deformylase,
FT                   score 6.4e-85"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS             complement(256046..256639)
FT                   /transl_table=11
FT                   /locus_tag="SUB0261"
FT                   /product="PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40783"
FT                   /db_xref="GOA:B9DTD7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD7"
FT                   /protein_id="CAR40783.1"
FT                   /translation="MSSKKYLRYSLLSASMFTLLAFVIINHFKVMTYIDNGLFNLLYDY
FT                   HSPWLTGVMIGISNIGSPAITSLLLILLILIYRQSSKQALFLMTFYFGTSALALVLKLV
FT                   IHRSRPLYQLLPDSGFSFPSGHSVCAVLLLLMVLFLLKENPTFLSLCIRCITFVFTLLV
FT                   LLSRVYLRDHFPTDILASLSLDFSSYYLLLAFIG"
FT   misc_feature    complement(256049..256441)
FT                   /locus_tag="SUB0261"
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily, score
FT                   2e-09"
FT                   /inference="protein motif:HMMPfam:PF01569"
FT   misc_feature    complement(order(256052..256120,256130..256198,
FT                   256217..256282,256325..256393,256412..256480,
FT                   256538..256606))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0261 by TMHMM2.0 at aa 12-34, 54-76, 83-105, 120-141,
FT                   148-170 and 174-196"
FT   sig_peptide     complement(256544..256639)
FT                   /locus_tag="SUB0261"
FT                   /note="Signal peptide predicted for SUB0261 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.740) with cleavage site
FT                   probability 0.737 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(256926..259049)
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="SUB0262"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40785"
FT                   /db_xref="GOA:B9DTD8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD8"
FT                   /protein_id="CAR40785.1"
FT                   /translation="MPTRYMQNRELAWLRFNERVLVEAEAAEVPLLEKLKFIAIFTSNL
FT                   DEFFMVRVGTLHDLMLMKKHKIDSKSDMTAAQQIDAILAMMPSLYQKRDRIYQTIMSDL
FT                   RDFHIRQLRFSELNEEQKTFANRFFKQRVDELISPQIIDMSHPLPFLENKRHYILTELE
FT                   KDDQKMFGLLPIREDFQQVLTLPGHQVDYILTEELILEKIEKIFNGYKVLNKGIIAVTR
FT                   NTDLNTDNENQDMFDNYRDFMKAIVKKRKRLNIVRLESQGPLSETSKAFLFDKLGLDED
FT                   HYLESQTPLSMEFVFNVMDIVPSAVKNDMLYPKINAYNPYKNTPSIIEKIRQEDQLLSY
FT                   PYDDIDAFVALLKEIAEDPQCRAIKITIYRLASQSKIAEQLIKAAENGIDVTVLMELKA
FT                   RFDEESNIQYASILEKAGCNVIYGFEEFKTHSKVFLAIFKDSSQNIHFITQLGTGNYNE
FT                   KTSRIYTDFSLLTANTEIGLDANDFFTHLALGNLNGKYKHLLQAPSSLRQQFVELIDRE
FT                   MAKGKDGYLFFKCNSFTDKVFIDKLVEASQAGCTIKLIIRGITCLLPGVEGVTDNIEIH
FT                   SIVGRYLEHPRVYIFGKDDQMAMYISSADLMTRNMEDRVEIAAPVYDKKIQKRIMTYMT
FT                   KQFSDTLKGRKISPEGEFLAIPVVKGQKAFSSQDAFIDEAEKQFQRQLRLESVQKVKRK
FT                   SPLRKFWNRFINK"
FT   misc_feature    complement(257019..259046)
FT                   /gene="ppk"
FT                   /locus_tag="SUB0262"
FT                   /note="HMMPfam hit to PF02503, Polyphosphate kinase, score
FT                   8.2e-174"
FT                   /inference="protein motif:HMMPfam:PF02503"
FT   CDS             complement(259076..259978)
FT                   /transl_table=11
FT                   /locus_tag="SUB0263"
FT                   /product="Ppx/GppA phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40786"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTD9"
FT                   /protein_id="CAR40786.1"
FT                   /translation="MNIAIVDIGSNTIRLNIYRLDKKEYSILFTKKYTASLASYVEDGK
FT                   LSRDGIDTLKRTISSIEEVTQFVELESIHYFATASLRNVSNQDEVIKEVKDDLNVTIDL
FT                   LAQSEEARLGHIGIEEVYGQSNGLSIDIGGGSTEIAIFKDKQIVKDFNLSDGSLSFYKK
FT                   YVEGILPTQDEFSQMSDKVKKSLKKNSDDLPSFDTLIGIGGSVRAIGKVIQKNENLDSP
FT                   LEFTIDQLKTLSKKLLKKDKKTLVAVFKVAPDRIHTLTPGVVILLEACKDFKVKTIRIS
FT                   DKGIREGYLLDYLNKKTTN"
FT   misc_feature    complement(259088..259933)
FT                   /locus_tag="SUB0263"
FT                   /note="HMMPfam hit to PF02541, Ppx/GppA phosphatase family,
FT                   score 4.4e-29"
FT                   /inference="protein motif:HMMPfam:PF02541"
FT   CDS             complement(260121..260789)
FT                   /transl_table=11
FT                   /locus_tag="SUB0264"
FT                   /product="Crp family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40787"
FT                   /db_xref="GOA:B9DTE0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE0"
FT                   /protein_id="CAR40787.1"
FT                   /translation="MKTISDTNLLNKLLKKHGLSHFFPSTVQKDLHLLLFQKNEAICLQ
FT                   DQDLDFIGYALEGAVKIVRRLPNGKEHVLETHARPSLIGDIELLTNQKAVTSVIALKST
FT                   YFIYLPLRDKKKLLKDPDFLYQIGQVLANNFYQQNVKSTQNMGYTVKERLARHILDQEN
FT                   NGVFGLELSLLADSFGTSYRHLHRVIQQLISQNIIERQAFKSYCITDFKSLEALALKEE
FT                   "
FT   misc_feature    complement(260220..260285)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1289.000, SD 3.58 at aa 169-190, sequence
FT                   LELSLLADSFGTSYRHLHRVIQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(260421..260702)
FT                   /locus_tag="SUB0264"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 1.8e-08"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   CDS             260883..262079
FT                   /transl_table=11
FT                   /locus_tag="SUB0265"
FT                   /product="Major Facilitator Superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40788"
FT                   /db_xref="GOA:B9DTE1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE1"
FT                   /protein_id="CAR40788.1"
FT                   /translation="MKDQLEKISLLSLSLMMISPFSVAPALPQMMAEYNAKGYSASQVT
FT                   ILFSLSSFAILAMLFLNPIISPYLTERKIISSGLLFIALGGGLPLVTQAYPLVFASRLL
FT                   LGAGIGLINAKVINIISERYQGKEKVRLLGYRSSAEVLGSSVFTFLAGFLVTLGWSKSF
FT                   AIYLFALLILALYLLFVPQLKEDKQKPRATQMDKKSFNSKDRLMIIGMAVYAGFVILIN
FT                   TSNTLRIPLVIEKMQLGSPKEASLILSLMMLMGILSGITFSRLLDIFKAFLLPIVAISL
FT                   GLGMLVLWAADNLILVGLGALVTGFIYSVGVTVVFNQLSEKIPPQELTKATTYVLIGCN
FT                   LGGGGAAIVLDLFSHFHHSITLPYLVYALLSLTLGVIMLIWIKGKIKLSVTFKKKRKS"
FT   sig_peptide     260883..260996
FT                   /locus_tag="SUB0265"
FT                   /note="Signal peptide predicted for SUB0265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.631) with cleavage site
FT                   probability 0.210 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(260901..260969,260997..261065,261102..261161,
FT                   261174..261242,261303..261359,261369..261422,
FT                   261501..261569,261612..261680,261693..261752,
FT                   261762..261830,261864..261932,261960..262028)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0265 by TMHMM2.0 at aa 7-29, 39-61, 74-93, 98-120,
FT                   141-159, 163-180, 207-229, 244-266, 271-290, 294-316,
FT                   328-350 and 360-382"
FT   misc_feature    260907..261947
FT                   /locus_tag="SUB0265"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 2.8e-29"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    261192..261269
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   CDS             262192..262461
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="SUB0266"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40789"
FT                   /db_xref="GOA:B9DTE2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTE2"
FT                   /protein_id="CAR40789.1"
FT                   /translation="MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNGHIKE
FT                   HKKDHATYRGLMKKIGHRRNLLAYLRRTDVNRYRELIQSLGLRR"
FT   misc_feature    262207..262455
FT                   /gene="rpsO"
FT                   /locus_tag="SUB0266"
FT                   /note="HMMPfam hit to PF00312, Ribosomal protein S15, score
FT                   2.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00312"
FT   CDS             263207..265405
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40790"
FT                   /db_xref="GOA:B9DTE3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTE3"
FT                   /protein_id="CAR40790.1"
FT                   /translation="MSKQTFSTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEIQVINTVLSYDENASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINP
FT                   DKAQMEASLLELTVAGSKEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEEIVA
FT                   AVGKEKAEVELLQVDADLQAEIVAKYNADLQKAVQVEEKKAREAATEAVKETVKAEYEA
FT                   KFAEDENLATIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAQIDFLPKV
FT                   HGSGLFTRGQTQALSVLTLAPMGDTQIIDGLDDEYKKRFLHHYNFPQYSVGETGRYGAA
FT                   GRREIGHGALGERALEQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGTNYTVLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIEGI
FT                   TPQILEEALAQAKKARFEILDLIETTIPAPRPELAPTAPKIDTIQIDVDKIKIVIGKGG
FT                   ETIDKIIAETGVKIDIDEEGLVQIFSSDQAAIDRTKEIITSLVREAKVGEVYHAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEIAWTRTANVSDVLEVGEEVDVKVIKVDDKGRVDASMKA
FT                   LIPRPPKPEKKEEKASEAKEASNDQASKSQSETASEEK"
FT   misc_feature    263237..263632
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF01138, 3' exoribonuclease family,
FT                   domain, score 3.7e-29"
FT                   /inference="protein motif:HMMPfam:PF01138"
FT   misc_feature    263639..263833
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF03725, 3' exoribonuclease family,
FT                   domain, score 9.7e-14"
FT                   /inference="protein motif:HMMPfam:PF03725"
FT   misc_feature    263924..264175
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF03726, Polyribonucleotide
FT                   nucleotidyltransferase,, score 3.7e-08"
FT                   /inference="protein motif:HMMPfam:PF03726"
FT   misc_feature    264182..264583
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF01138, 3' exoribonuclease family,
FT                   domain, score 4.9e-41"
FT                   /inference="protein motif:HMMPfam:PF01138"
FT   misc_feature    264590..264802
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF03725, 3' exoribonuclease family,
FT                   domain, score 3.4e-26"
FT                   /inference="protein motif:HMMPfam:PF03725"
FT   misc_feature    264878..265051
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF00013, KH domain, score 1.8e-13"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    265067..265285
FT                   /gene="pnpA"
FT                   /gene_synonym="comR"
FT                   /locus_tag="SUB0267"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   8e-22"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS             265417..266157
FT                   /transl_table=11
FT                   /locus_tag="SUB0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40792"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE4"
FT                   /protein_id="CAR40792.1"
FT                   /translation="MNELDTRLRAFINSPDNFLDSVALVNAFHHFPVWASKEFYTITIE
FT                   GQELVPVFTDKDDMALFKADQTDAQSQYWLERSAIAVLEEVIKKGASGLVFNLKKKGDF
FT                   GNSTVFKSSDMIQFLNTFTTILNQVMSDENQEADTFEKIYFVPAFVQVKSENYYDRFFP
FT                   TMSTPEGKSYIPAFSNLQSFAKWYNQDDFGGAFRRAQGVILTWKLEDIYQPRNGENERD
FT                   ETVGVAVNPFDEEQILIDWTDIEK"
FT   CDS             266170..266754
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SUB0269"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40795"
FT                   /db_xref="GOA:B9DTE5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE5"
FT                   /protein_id="CAR40795.1"
FT                   /translation="MGWWKKSINIVKDLDPAARNSLEVLLTYPGIKALAAHRLSHFLWE
FT                   HNFKLLARMNSQFWRFLTNIEIHPGAKIAAGVFIDHGAGLVIGETAEVEEGVMLYHGVT
FT                   LGGTGKDKGKRHPTIRKGALISAHSQIIGPIEVGENAKVGAAAVVLSDVPADVTVVGVP
FT                   AKVVRVHGQKDAITIKSMEEKREESYYSSKL"
FT   misc_feature    266359..266412
FT                   /gene="cysE"
FT                   /locus_tag="SUB0269"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 0.71"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    266437..266490
FT                   /gene="cysE"
FT                   /locus_tag="SUB0269"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 3"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    266515..266568
FT                   /gene="cysE"
FT                   /locus_tag="SUB0269"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 56"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    266569..266622
FT                   /gene="cysE"
FT                   /locus_tag="SUB0269"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 24"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS             266780..268120
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SUB0270"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40797"
FT                   /db_xref="GOA:B9DTE6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE6"
FT                   /protein_id="CAR40797.1"
FT                   /translation="MIKIYDTMTRQLRDFKPINDNQVNMYVCGPTVYNYIHIGNARSAV
FT                   AFDTIRRYFEYSGYQVNYISNFTDVDDKIIKAAAENGVTPKELADRFIAAFMEDTSKLG
FT                   IKPATKNPRVMDYMDEIIAFISVLMEKGFAYQVAGDVYFRVAKSENYARLANKTLADLE
FT                   VGASGRTDSETDLKENPLDFALWKSAKSGEISWESPWGPGRPGWHIECSVMATELLGHT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGHTFANYWMHNGFVNVDNEKMSKSLGNFVTVHD
FT                   MLKTVDGQVLRFFLATQQYRKPINFTEKAIHDAEVNLKYLKNTYRLPVAETSDLGYKTY
FT                   IEAFKAAMDDDFNAANGITVVFDFAKWINSGHYSAEIKTAFEEMLAVFGIVFEEEVLDA
FT                   DIEALIAERQEARAQRDFAKADQIRDQLASQGIKLLDTKDGVRWTRD"
FT   misc_feature    266819..267727
FT                   /gene="cysS"
FT                   /locus_tag="SUB0270"
FT                   /note="HMMPfam hit to PF01406, tRNA synthetases class I (C)
FT                   catalytic d, score 5e-183"
FT                   /inference="protein motif:HMMPfam:PF01406"
FT   CDS             268113..268508
FT                   /transl_table=11
FT                   /locus_tag="SUB0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40799"
FT                   /db_xref="GOA:B9DTE7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE7"
FT                   /protein_id="CAR40799.1"
FT                   /translation="MTNVDVNLINGIALAFEGDAVYSYYIRKHLIFSGQTKPSQLHHMA
FT                   TRYVSAKAQASLIQKMLEAQLLTEKEEDIYRRGRNSHSHTKAKNADVVTYRMSTGFEAV
FT                   MGYLDMTDQKDRLETLINWCIQEVEKA"
FT   misc_feature    268152..268451
FT                   /locus_tag="SUB0271"
FT                   /note="HMMPfam hit to PF00636, RNase3 domain, score
FT                   1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00636"
FT   CDS             268646..269044
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0272"
FT                   /product="putative membrane protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   regions of Streptococcus pyogenes (serotype M18)
FT                   hypothetical protein spym18_2006. UniProt:Q8NZD2_STRP8
FT                   (EMBL:AE010104) (265 aa) fasta scores: E()=3.1e-05, 28.777%
FT                   id in 139 aa, and Streptococcus pyogenes hypothetical
FT                   protein spy1939. UniProt:Q99Y01_STRPY (EMBL:AE006617) (265
FT                   aa) fasta scores: E()=3.1e-05, 28.777% id in 139 aa.
FT                   Missing C-terminal region contains transmembrane domain"
FT                   /db_xref="PSEUDO:CAR40801.1"
FT   CDS             269139..269894
FT                   /transl_table=11
FT                   /locus_tag="SUB0273"
FT                   /product="SpoU rRNA methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40803"
FT                   /db_xref="GOA:B9DTE9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTE9"
FT                   /protein_id="CAR40803.1"
FT                   /translation="MKTMKDKHLQETTDMVYGVHAVTESLNANTGNKLYIQEDLRGKNV
FT                   DAIKALATEKKVSISWTPKKTLSEMTEGAVHQGFVLRVSEYAYAELADILKKAESEENP
FT                   LIMILDGITDPHNFGSILRTADATKVCGIIIPKHRAVGVTPVVSKTSTGAVEHLPIARV
FT                   TNLSQTLDKLKEAGFWIFGTDMDGTPVQKWNTSGKLALIIGSEGKGISHNIKKQVDEMI
FT                   TIPMDGHVQSLNASVAAAVLMYEVFRNKL"
FT   misc_feature    269448..269870
FT                   /locus_tag="SUB0273"
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 2e-49"
FT                   /inference="protein motif:HMMPfam:PF00588"
FT   CDS             269903..270418
FT                   /transl_table=11
FT                   /locus_tag="SUB0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40804"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF0"
FT                   /protein_id="CAR40804.1"
FT                   /translation="MKKRRLLVDGYNMIAFWEETRQLFKTNQLDQARTVLLNKLNNYAH
FT                   FEKIEITCVFDAQFVPGVRQRYDQYMISVIFTEEDETADAYIERMAAELNTSLNLVEVA
FT                   TSDLNEQWAIFSQGALRVPARELERRVNTVKSDLDKMSKSIEMKKPKLRPFEEANLQKL
FT                   KDFMDDLG"
FT   misc_feature    269909..270412
FT                   /locus_tag="SUB0274"
FT                   /note="HMMPfam hit to PF05991, Protein of unknown function
FT                   (DUF901), score 5.5e-86"
FT                   /inference="protein motif:HMMPfam:PF05991"
FT   CDS             270574..271434
FT                   /transl_table=11
FT                   /locus_tag="SUB0275"
FT                   /product="DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40806"
FT                   /db_xref="GOA:B9DTF1"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF1"
FT                   /protein_id="CAR40806.1"
FT                   /translation="MSFVLLTDSTADLDGQWAKANKVDLLGLTIECDGITYETVGPNAL
FT                   DSETLLAKMTAGSKPKTSQINVGTFEEYFRQKVKAGQAVLYIAFSSILSGTYQSAVMAR
FT                   QMVLDDYPEAVIEIVDTLAAAGGEGYLVMLAVEARDQGQSLEAVKLLIEDTAPRLRTYF
FT                   LVDDLYHLMRGGRLSKSSAILGSIASIKPILWIDAQGKLVPISKARGRKKALRDMEERI
FT                   ASDIDASRVVIAHSVDPEGAEELKASLLANPKISDVLVMPLGPVIAAHVGPKTLAAFVI
FT                   GLKER"
FT   misc_feature    270787..271422
FT                   /locus_tag="SUB0275"
FT                   /note="HMMPfam hit to PF02645, Uncharacterized protein,
FT                   DegV family COG1307, score 4.4e-70"
FT                   /inference="protein motif:HMMPfam:PF02645"
FT   CDS             271630..272076
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SUB0276"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40808"
FT                   /db_xref="GOA:B9DTF2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF2"
FT                   /protein_id="CAR40808.1"
FT                   /translation="MNKTTFMAKTGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSMYPGGLKAISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGPEHTHAAQQPEVLDISGLI"
FT   misc_feature    271678..272061
FT                   /gene="rplM"
FT                   /locus_tag="SUB0276"
FT                   /note="HMMPfam hit to PF00572, Ribosomal protein L13, score
FT                   3e-68"
FT                   /inference="protein motif:HMMPfam:PF00572"
FT   misc_feature    271948..272016
FT                   /note="PS00783 Ribosomal protein L13 signature."
FT                   /inference="protein motif:Prosite:PS00783"
FT   CDS             272098..272490
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SUB0277"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40810"
FT                   /db_xref="GOA:B9DTF3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTF3"
FT                   /protein_id="CAR40810.1"
FT                   /translation="MAQAQYAGTGRRKNAVARVRLVPGTGKITVNSKDVEEYIPHADLR
FT                   LVINQPFAVTSTEGSYDVFVNVNGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDARMVERKKPGLKKARKASQFSKR"
FT   misc_feature    272125..272487
FT                   /gene="rpsI"
FT                   /locus_tag="SUB0277"
FT                   /note="HMMPfam hit to PF00380, Ribosomal protein S9/S16,
FT                   score 1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF00380"
FT   misc_feature    272302..272358
FT                   /note="PS00360 Ribosomal protein S9 signature."
FT                   /inference="protein motif:Prosite:PS00360"
FT   CDS             272932..273432
FT                   /transl_table=11
FT                   /locus_tag="SUB0278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40811"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF4"
FT                   /protein_id="CAR40811.1"
FT                   /translation="MEHQVSDALLKAGVELGVLAVKGTTTLVNSKIQSIKDERSAEKLR
FT                   NTYDEIINELLSEREQAIRIAQAYKEEYEKVNINDEDIEYLHKTLTQMISLISSFTKVD
FT                   SEQEASMTQLVELLNKDTLKTMQLLGFNYKEAIGEPLTEVCATTIKSKLSPSPKRNNKP
FT                   QRK"
FT   CDS             273753..275303
FT                   /transl_table=11
FT                   /locus_tag="SUB0279"
FT                   /product="type I restriction-modification system M protein"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40812"
FT                   /db_xref="GOA:B9DTF5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF5"
FT                   /protein_id="CAR40812.1"
FT                   /translation="MSEQAQRQELHSKIWKIADDVRGAVDGWDFKQYILGILFYRFISE
FT                   NFKNYMEAGDPNINYENVPESLITDDIKDDAVKTKGYFIMPNQLFSNIVKSARTNDNLN
FT                   TDLKAIFDAIQASAIGYESENDIKGLFDDVDTTSNRLGNTVPEKNKRLADILEGIASLN
FT                   FGHFEDNKIDLFGDAYEYLISNYASNAGKSGGEFFTPQNVSKLLAKIVMLGRSESNKIN
FT                   KIYDPACGSGSLLLQAQKQFTEHVIEDGFYGQEINLTTYNLARMNMFLHNINYDKFNIQ
FT                   RGDTLTDPKHGNDKPFDAIVSNPPYSINWIGKDDPTLINDDRFAPAGVLAPKSKADFAF
FT                   IMHSLSYLSAQGRAAIVVFPGILYRGGAEQKIRKYLVDNNFVEAIIQLPNNLFFGTSIA
FT                   TCILVLAKNKTNTDTLFIDASAEFKKATNNNVLTEENIDKILESIENKENKDYFAQVVP
FT                   YETIVEGDYNLSVSTYLEKEDTREKIDIDVLNNEIKETVLKIDQLRLEIDKIVLDLSK"
FT   misc_feature    273768..274523
FT                   /locus_tag="SUB0279"
FT                   /note="HMMPfam hit to PF02506, Type I restriction
FT                   modification system, M, score 1.1e-117"
FT                   /inference="protein motif:HMMPfam:PF02506"
FT   misc_feature    274650..274670
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   misc_feature    274674..275156
FT                   /locus_tag="SUB0279"
FT                   /note="HMMPfam hit to PF02384, N-6 DNA Methylase, score
FT                   1.9e-80"
FT                   /inference="protein motif:HMMPfam:PF02384"
FT   CDS             join(275314..276480,276479..277030)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0280"
FT                   /product="type I restriction-modification system S protein
FT                   (pseudogene)"
FT                   /note="Similar to Streptococcus mutans putative type I
FT                   restriction-modification system, specificity determinant
FT                   HsdS UniProt:Q8DUM6_STRMU (EMBL:AE014930) (603 aa) fasta
FT                   scores: E()=4.5e-66, 46.179% id in 615 aa. CDS contains a
FT                   frameshift after codon 389"
FT                   /db_xref="PSEUDO:CAR40815.1"
FT   misc_feature    275359..275790
FT                   /locus_tag="SUB0280"
FT                   /note="HMMPfam hit to PF01420, Type I restriction
FT                   modification DNA speci, score 5.9e-39"
FT                   /inference="protein motif:HMMPfam:PF01420"
FT   misc_feature    275887..276342
FT                   /locus_tag="SUB0280"
FT                   /note="HMMPfam hit to PF01420, Type I restriction
FT                   modification DNA speci, score 1.9e-15"
FT                   /inference="protein motif:HMMPfam:PF01420"
FT   CDS             277059..280154
FT                   /transl_table=11
FT                   /locus_tag="SUB0282"
FT                   /product="type I restriction-modification system R protein"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40817"
FT                   /db_xref="GOA:B9DTF7"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF7"
FT                   /protein_id="CAR40817.1"
FT                   /translation="MDRLTQTATIAETNKFIVLEKYTKLVQPSTYQTEADLERELIADL
FT                   QKQGYDYLNYVITPEALLANLKIQIENLNGVTFTNNEWSRLLVEYINKPSDTLIDCTRR
FT                   LHDDFIYDFTFDDGHLQNIYLLDKKNINRNKVQVINQMTQIGTSSNRYDVTILINGLPM
FT                   VQIELKKRGVAIREAFNQMHRYTKESFNESHSLYKYLQIFVISNGTDTRYFANTTKREK
FT                   HSFDFTMNWALKNNDPIKDLKDFTATFLSKNTLLNVLINFTVFDTSDTLLIMRPYQIAA
FT                   TERIIWKIKSTLEGKLKSGIETGGYIWHTTGSGKTLTSFKAARLATEMEGIDKVFFVVD
FT                   RKDLDYQTMKEYQRFSPDSVNGSENTAGLKRNIEKTDNKIIVTTIQKLNNFMKTELNHE
FT                   VYNQQVVFIFDECHRSQFGEAQKNLRRKFKRYSQFGFTGTPIMVENALGSETTQSVFGD
FT                   ELHSYVITDAIRDQKVLKFMVDYNDVRPQFQSIETEQNLEKLSAAENKKALLHPTRISE
FT                   ITSYILENYHIKTHRTGNNGFNAMFAVSSVEAAKLYYQEFKKQQSHHDKPLKVATIFSY
FT                   AANEEQAALGDILDETFTPDNMADQSSKEFLSACIDDYNTMFQTTFTINGNDFQNYYRD
FT                   LAKRVKNREVDLIIVVGMFLTGFDAPTLNTLFVDKNLRYHGLIQAFSRTNRIYNATKSF
FT                   GNIVTFRDLEEATTAAIKLFGKTQTAEILLERKFEDYMTGYTDGGEAKSGYLEVVKELQ
FT                   ERFPHPEEIVKEADKKEFVKLFGQFLKLDNILRNYDEYTQLQVLQTIDVEDQSQLDAFV
FT                   QKYQLDKEQLDLLIDAPFPTPRQIQDYRSTYNDIKDWYHNERRNIEDEKSKVNWDEITF
FT                   EVELLKSQEINLDYILELILETNKKVSTKSDLIEEITRTIRASLGNRAKEDLIVDFIHQ
FT                   TDIDSIVDKSDIIERFFAFARKEQAKEVEQLIKDENLNEANAKRYIKTSLKREYASENG
FT                   TELNETLPKLSPLNPTYRTKKQTVFEKISQLVEKYKGVGGDF"
FT   misc_feature    277149..277724
FT                   /locus_tag="SUB0282"
FT                   /note="HMMPfam hit to PF04313, Type I restriction enzyme R
FT                   protein N termin, score 8.2e-50"
FT                   /inference="protein motif:HMMPfam:PF04313"
FT   misc_feature    277872..278384
FT                   /locus_tag="SUB0282"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 2.5e-50"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    279186..279209
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             280220..280387
FT                   /transl_table=11
FT                   /locus_tag="SUB0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40819"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF8"
FT                   /protein_id="CAR40819.1"
FT                   /translation="MFEKIIEDVQSLDEVSLIKAFEEESDPLKKDLFQAFLDYNGRMRQ
FT                   REVIKKGFTI"
FT   CDS             complement(280554..281306)
FT                   /transl_table=11
FT                   /locus_tag="SUB0284"
FT                   /product="DeoR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40821"
FT                   /db_xref="GOA:B9DTF9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTF9"
FT                   /protein_id="CAR40821.1"
FT                   /translation="MLKEERQKKIIDILNIENKVIASELSSRLKVSEDTIRRDLKELDM
FT                   QGLVRRVRKGALRIGPPITQFTYREHDNTELKRVLAAKALPLIKEDTVILIDGSSTNLF
FT                   LVKLIPIDFSATIITNSPPIAISLSNHKNINIIMLGGSLYKNSMINVGIETIRSLEHIR
FT                   VDTYIIGVYNIDFENGMSVPTQTEAEVKRKMIEISTEVIGLISADKFATVSNYIVAPAK
FT                   DINYIVTHDLPETTRHEFSKIKTINIID"
FT   misc_feature    complement(280617..281291)
FT                   /locus_tag="SUB0284"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 2e-35"
FT                   /inference="protein motif:HMMPfam:PF00455"
FT   misc_feature    complement(281184..281249)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1056.000, SD 2.78 at aa 20-41, sequence
FT                   VIASELSSRLKVSEDTIRRDLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(281187..281291)
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00894"
FT   CDS             281503..282192
FT                   /transl_table=11
FT                   /gene="RPE"
FT                   /locus_tag="SUB0285"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="Similar to the C-terminal region of Spinacia
FT                   oleracea (Spinach) ribulose-phosphate 3-epimerase,
FT                   chloroplast precursor RPE (ec 5.1.3.1) (pentose-5-phosphate
FT                   3-epimerase) UniProt:RPE_SPIOL (EMBL:AF070941) (285 aa)
FT                   fasta scores: E()=2.9e-21, 38.614% id in 202 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40822"
FT                   /db_xref="GOA:B9DTG0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG0"
FT                   /protein_id="CAR40822.1"
FT                   /translation="MNKIVMSPSIMCADLVNLERDIKVLEESGLDTLHIDLIDGNFSPA
FT                   MPLGIDTVKRMRAITDMNFDIHIMATENEFFISEMLKIGVQSVTFHYETSRHISRYIQM
FT                   IHEAGAKVGIALNPATSLTELEYILPEVDMVTLMLINPGFATNKNETQVSYAAKKISDL
FT                   KKLIDNNGYKISIQVDGRVSLDSIPSLVKAGADNLVLGSTSLFIKGNTIIENKKLVLDS
FT                   INRGLGE"
FT   misc_feature    281515..282129
FT                   /gene="RPE"
FT                   /locus_tag="SUB0285"
FT                   /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
FT                   epimerase family, score 1.4e-54"
FT                   /inference="protein motif:HMMPfam:PF00834"
FT   CDS             282185..282751
FT                   /transl_table=11
FT                   /locus_tag="SUB0286"
FT                   /product="putative 6-phospho-3-hexuloisomerase"
FT                   /note="Similar to Bacillus methanolicus
FT                   6-phospho-3-hexuloisomerase Phi UniProt:Q6TV53_BACMT
FT                   (EMBL:AY386313) (184 aa) fasta scores: E()=3.7e-20, 38.764%
FT                   id in 178 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40823"
FT                   /db_xref="GOA:B9DTG1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG1"
FT                   /protein_id="CAR40823.1"
FT                   /translation="MNKMSFKNSQADIIKELTSTLENIEESQVDILINELLKAKRVFFV
FT                   GVGRVLLSLEAIAKRLAHIGVDTVIVGEITEPAITDEDLLIVGSGSGESLFPLMIAKKA
FT                   KSYNAKVLHIGSNPNSSMKEFSDHFVRIPVQTKLGLEGEVASIQPMTSLFEQSLLLLGD
FT                   SIALELVRRDGIDMKSLWKFHANLE"
FT   misc_feature    282281..282673
FT                   /locus_tag="SUB0286"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 1.7e-07"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS             282762..283940
FT                   /transl_table=11
FT                   /locus_tag="SUB0287"
FT                   /product="putative mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40827"
FT                   /db_xref="GOA:B9DTG2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG2"
FT                   /protein_id="CAR40827.1"
FT                   /translation="MKAVHFGAGNIGRGFIGNILHDSGYELLFVDMDKNLVQQIHNDRE
FT                   YEIQILDFDQDPIIIDNVDAILGNSTELVIEELVKADIITTSVGANNLKYLAQNMKNAL
FT                   LKRAELKTTVTVIANENTINATDILSEEIFNICSEAERDKILSITNFVNSAIDRQAMSK
FT                   NYNGKSVALVEKYFEWVIEKNDYTKEIEGIIASAKFVEDLEPYIERKLFLVNAEHAAFA
FT                   YLGKLFGYKTVQSSADNKDILNLVKRMTIENSRYFKTKYNMDPVELESFISKTLLRHTN
FT                   PKFSDEVERVGRNPIRKLGPRDRLISPFVKLTELSLPNICLTKVIAAALFFTDESDSES
FT                   LQLQAMIAKEGVETVLEKICGLSEVLITQIMKEYNSIKSDPNNIFRGVVNDY"
FT   misc_feature    282762..283877
FT                   /locus_tag="SUB0287"
FT                   /note="HMMPfam hit to PF01232, Mannitol dehydrogenase,
FT                   score 5e-69"
FT                   /inference="protein motif:HMMPfam:PF01232"
FT   CDS             283930..284361
FT                   /transl_table=11
FT                   /locus_tag="SUB0288"
FT                   /product="sugar phosphotransferase system (PTS), IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40829"
FT                   /db_xref="GOA:B9DTG3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG3"
FT                   /protein_id="CAR40829.1"
FT                   /translation="MIIDLLKNNIQIIDSVESWEKAITISAAPLLMGGKIEERYIDAII
FT                   ENVKINGNYIILLPFIAMPHARREYGALDTGLSLLKVKKPVNFPNNEPVTIFLTISANS
FT                   DSGHLEMLSQLSEILIDTEKVDKLLNAANKDEILNVFGE"
FT   misc_feature    283936..284358
FT                   /locus_tag="SUB0288"
FT                   /note="HMMPfam hit to PF00359,
FT                   Phosphoenolpyruvate-dependent sugar phosph, score 1.2e-35"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   CDS             284364..285776
FT                   /transl_table=11
FT                   /locus_tag="SUB0289"
FT                   /product="putative mannitol-specific phosphotransferase
FT                   system (PTS), IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to the N-terminal region of Escherichia coli
FT                   PTS system, mannitol-specific IIABC component MtlA
FT                   UniProt:PTMA_ECOLI (EMBL:ECUW76) (637 aa) fasta scores:
FT                   E()=6.9e-92, 51.502% id in 466 aa"
FT                   /note="Similar to the N-terminal region of SUB0997, 50.951%
FT                   identity (51.940% ungapped) in 473 aa overlap
FT                   (1-466:1-471)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40831"
FT                   /db_xref="GOA:B9DTG4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG4"
FT                   /protein_id="CAR40831.1"
FT                   /translation="MERKISNRAKIQAFGGFLTNMVLPNIGAFIAWGIVTAFFIPTGWT
FT                   PNKHLSELVGPTVTYLLPLLLAYTGGKMVGGNRGAVLGSIATIGAIIGSDIPMFLGAMI
FT                   LGPLGGYIMKKADKILENKIPAGFEMIVNNFSIGILGFFLMILSFLVIGPVVGQLNGLV
FT                   EASVQVLVKHKLLPLVALINEPAKVLFLNNVIDQGIYYPLGTQQTLKLGKSIYFMLASN
FT                   PGPGLGLLLAYTVFGKKAAKRTAPGAIIIHFLGGIHEMYFPYVLMKPLTIIGMIGGAMS
FT                   GIVTAQIFKVGLVGGPSPGSIIAYLALTPRGNFIGVIAAVTIATLVSFLITSVILKADK
FT                   TEEEDHFDEMVSKSKEMKAEGKNITNQSLPANITKYTKISYACDAGMGSSAMGATIFRK
FT                   KLKEAGIEDVEVKHYRIEDIPEDSDLAVIHEDLAERAKMAHPNLTIVPISNYLQDLAID
FT                   NLVNEVVKVNKN"
FT   misc_feature    284418..285197
FT                   /locus_tag="SUB0289"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 4.4e-18"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    order(284424..284492,284520..284588,284607..284675,
FT                   284766..284834,285006..285074,285102..285158,
FT                   285177..285245,285303..285371)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0289 by TMHMM2.0 at aa 21-43, 53-75, 82-104, 135-157,
FT                   215-237, 247-265, 272-294 and 314-336"
FT   misc_feature    285495..285761
FT                   /locus_tag="SUB0289"
FT                   /note="HMMPfam hit to PF02302, PTS system,
FT                   Lactose/Cellobiose specific IIB, score 8e-13"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS             285789..286433
FT                   /transl_table=11
FT                   /gene="tal2"
FT                   /locus_tag="SUB0290"
FT                   /product="probable transaldolase 2"
FT                   /note="Similar to SUB1428, 92.523% identity (92.523%
FT                   ungapped) in 214 aa overlap (1-214:13-226)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40832"
FT                   /db_xref="GOA:B9DTG5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG5"
FT                   /protein_id="CAR40832.1"
FT                   /translation="MKFFLDTANVEAIKSINELGLVDGITTNPTIISREGRDFETVIKE
FT                   ICQIVDGPVSAEVTGLTAEEMVAEAREIAKWHDNVVVKIPMTKDGLKATNILSKEGIKT
FT                   NVTLIFTVSQGLMAMKAGATYISPFVGRLEDIGTDPYQLIEDLRDIIDLYSFDTEIIAA
FT                   SIRNAAHVEAVAKIGAHIATIPEGIFEKMTKHPLTTSGIDQFMKDWSSFKK"
FT   misc_feature    285792..286424
FT                   /gene="tal2"
FT                   /locus_tag="SUB0290"
FT                   /note="HMMPfam hit to PF00923, Transaldolase, score
FT                   2.3e-63"
FT                   /inference="protein motif:HMMPfam:PF00923"
FT   misc_feature    285858..285884
FT                   /note="PS01054 Transaldolase signature 1."
FT                   /inference="protein motif:Prosite:PS01054"
FT   CDS             286489..288474
FT                   /transl_table=11
FT                   /gene="tkt2"
FT                   /gene_synonym="tktA2"
FT                   /locus_tag="SUB0291"
FT                   /product="putative transketolase 2"
FT                   /EC_number="2.2.1.1"
FT                   /note="Identical to SUB1427, 100.000% identity (100.000%
FT                   ungapped) in 661 aa overlap (1-661:1-661)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40834"
FT                   /db_xref="GOA:B9DTG6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG6"
FT                   /protein_id="CAR40834.1"
FT                   /translation="MTFDAVDQLAVNTVRTLSMDAIQKANSGHPGLPMGAAPMAYVLWN
FT                   RFMTVNPKTSRNWTNRDRFVLSAGHGSAMLYSLLHLAGYNLSIEDIKNFRQWGSKTPGH
FT                   PEVNHTDGVEATTGPLGQGIANAVGLAMAEAHLAAKYNKPGYNIVDHYTYALNGDGDLM
FT                   EGVSQEAASLAGHLKLGKLVLLYDSNDISLDGPTSMAFTEDVKGRFEAYGWQHILVKDG
FT                   NDLEAIAKALEEAKAETQKPTIIEVKTIIGYGAEKQGTSAVHGAPLGAEGIAFAKKAYQ
FT                   WTAEDFEVPAEVSKRFEEGIQTKGAQAEAAWNELFAAYEKEYPELAADYKAAFANEPVS
FT                   VDLAAHELGTSKASRVSSQEAIQQISEQVSSFWGGSADLSASNNTMVKVEKDFQPGQYE
FT                   GRNIWFGVREFAMAAAMNGIALHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTMYVMT
FT                   HDSIAVGEDGPTHEPIEQLASVRSMPNLNVIRPADGNETNAAWKRALAETDKPTMLVLT
FT                   RQNLPVLEGTKELAEEGLNKGAYILSEAKGEMDGIIIATGSEVKLAMDTQAALAEEGIH
FT                   VRVVSMPSQNIFDVQSDAYKEEILPAAITKRLAIEAASSFGWAKYVGLAGKTLTIDTWG
FT                   ASAPGNRIFEEYGFTTENATALYKSL"
FT   misc_feature    286504..287502
FT                   /gene="tkt2"
FT                   /gene_synonym="tktA2"
FT                   /locus_tag="SUB0291"
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate b, score 8.1e-203"
FT                   /inference="protein motif:HMMPfam:PF00456"
FT   misc_feature    286531..286593
FT                   /note="PS00801 Transketolase signature 1."
FT                   /inference="protein motif:Prosite:PS00801"
FT   misc_feature    287542..288057
FT                   /gene="tkt2"
FT                   /gene_synonym="tktA2"
FT                   /locus_tag="SUB0291"
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domai, score 6.7e-61"
FT                   /inference="protein motif:HMMPfam:PF02779"
FT   misc_feature    287881..287931
FT                   /note="PS00802 Transketolase signature 2."
FT                   /inference="protein motif:Prosite:PS00802"
FT   misc_feature    288121..288450
FT                   /gene="tkt2"
FT                   /gene_synonym="tktA2"
FT                   /locus_tag="SUB0291"
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal
FT                   domain, score 5.6e-05"
FT                   /inference="protein motif:HMMPfam:PF02780"
FT   CDS             288519..288632
FT                   /transl_table=11
FT                   /locus_tag="SUB0292"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40836"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG7"
FT                   /protein_id="CAR40836.1"
FT                   /translation="MFEKMMKLSVFNSKSDFCHEINNYSKNTPNCIFICIF"
FT   CDS             288725..288805
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0292A"
FT                   /product="putative dihydrolipoamide dehydrogenase
FT                   (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus mutans putative dihydrolipoamide
FT                   dehydrogenase PdhD UniProt:Q8DTC8_STRMU (EMBL:AE014975)
FT                   (445 aa) fasta scores: E()=0.0067, 80.000% id in 25 aa"
FT   CDS             join(288832..288954,288956..289375)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0293"
FT                   /product="acetoin(diacetyl) reductase (pseudogene)"
FT                   /EC_number="1.1.1.5"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Klebsiella pneumoniae acetoin(diacetyl) reductase
FT                   (ec 1.1.1.5) BudC UniProt:BUDC_KLEPN (EMBL:AF098800) (256
FT                   aa) fasta scores: E()=4.6e-35, 61.878% id in 181 aa"
FT   misc_feature    289019..289105
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS             289561..289803
FT                   /transl_table=11
FT                   /locus_tag="SUB0295"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40843"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG8"
FT                   /protein_id="CAR40843.1"
FT                   /translation="MRFLETVNNQFKLATLQYINQLHVKYEDRIENRWIWIVVAMIVFA
FT                   AIGLYAWYCTSRGYSFAFNIKYNWPKSGQMGIACK"
FT   misc_feature    289660..289719
FT                   /note="1 probable transmembrane helix predicted for SUB0295
FT                   by TMHMM2.0 at aa 34-53"
FT   CDS             289860..290588
FT                   /transl_table=11
FT                   /locus_tag="SUB0296"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40844"
FT                   /db_xref="GOA:B9DTG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTG9"
FT                   /protein_id="CAR40844.1"
FT                   /translation="MYKIHHLKKSYGNRSVLNGINCQFPNNGVVILVGTNGCGKTTFMN
FT                   VLTEMTGFMSGKIFCNQFAIGSREYKEQIFYIPSDFYLPEFMTGREYLDFILKRYKTSD
FT                   FNNIEILLEVFDLKGFENELIEKYSFGMKKKIQIIAAFCSGTPYILADELFSGLDFDTV
FT                   ILLEDIIEYQKNKKCFIIVSHDRNTLERFPNHIYIMSKGKLLSYKERNMSVSDMIRQMG
FT                   GISGKISKLQERFGNDSSLP"
FT   misc_feature    289938..290465
FT                   /locus_tag="SUB0296"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.1e-18"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    289959..289982
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    290241..290285
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             290569..291885
FT                   /transl_table=11
FT                   /locus_tag="SUB0297"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40846"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH0"
FT                   /protein_id="CAR40846.1"
FT                   /translation="MIHLFLNDSFHGICNRSILRNAYGRVILSILFCSAYFLYFYVNAI
FT                   EFAKLGQTRQIFSVEELNKVIKLSIASYNNLSFILGILIYQLAQYLILIKNSSLFIVKS
FT                   LPYPNKEINFAIHLFKLGVSSIIYELFFIVLMPGLQVIGSVNIALFLFCSCHLFFLIGY
FT                   LTSFHAYRLANKYLDVIYLKIKPIISVIILSLTAYYYYIGRFIVEFALSKQVSNALELA
FT                   IDSFIFSLVISILLFSFFSFQNEEYFFKNVYLPLAFPKYVPRLLLGLLRTKLFAISNGI
FT                   LFLLSLYTFTIAGCKAMLEVIAPLYPLLNIIFLRYIDTTIHVRRLFSHLNITVIQEWLS
FT                   ILFSILIYQLPLIVLQLVLPMDFRNVCFGQALALASVIIGYLFPKSESSLNDTVAVILL
FT                   FLIVVIIIMVKTSNLSIVIAYSGLSLFLFYLLVRERRLT"
FT   misc_feature    order(290629..290697,290800..290868,290905..290973,
FT                   291001..291069,291103..291171,291229..291297,
FT                   291388..291447,291460..291519,291580..291648,
FT                   291664..291717,291736..291795,291808..291864)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0297 by TMHMM2.0 at aa 21-43, 78-100, 113-135, 145-167,
FT                   179-201, 221-243, 274-293, 298-317, 338-360, 366-383,
FT                   390-409 and 414-432"
FT   CDS             291882..292148
FT                   /transl_table=11
FT                   /locus_tag="SUB0298"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40848"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH1"
FT                   /protein_id="CAR40848.1"
FT                   /translation="MIQKYSKQFCYVNLFWVIIFLIDYGIELFQVSNSERITMMGLFIK
FT                   NTENDNGIYTIFGMTPKLFMVYFSIVLGWLMIYAIFEKIWRKS"
FT   misc_feature    order(291906..291974,292068..292136)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0298 by TMHMM2.0 at aa 9-31 and 63-85"
FT   CDS             292151..292498
FT                   /transl_table=11
FT                   /locus_tag="SUB0299"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40849"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH2"
FT                   /protein_id="CAR40849.1"
FT                   /translation="MSTYLLMISITFLLVCVHEGIHFLTAYIMGLSPKLNCHVLKPSVY
FT                   FKNKRNDIKNLIVAASSPLLLTSYGVMMNPEDILTLYTKILCLTNLLNFLPFTSDGEVI
FT                   LISIINLVRRK"
FT   misc_feature    order(292178..292246,292307..292375,292418..292486)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0299 by TMHMM2.0 at aa 10-32, 53-75 and 90-112"
FT   CDS             292507..292998
FT                   /transl_table=11
FT                   /locus_tag="SUB0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40851"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH3"
FT                   /protein_id="CAR40851.1"
FT                   /translation="MLALFSFMIILLLLNSVAYRMNTREGKFEIEKSISLLQEPVDVTM
FT                   NHLSHKKPGIYYFGYQKCPWCEEFLPILDEVLKENNQKSIVVNIKTTSFTKKHKRALKK
FT                   FYETYENGEVSVPYLVIINSKGNVYTHVGTLSEHYAHKEKLTNSQRNKLKSVLRRKLRY
FT                   "
FT   CDS             293111..293641
FT                   /transl_table=11
FT                   /locus_tag="SUB0301"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40852"
FT                   /db_xref="InterPro:IPR014591"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH4"
FT                   /protein_id="CAR40852.1"
FT                   /translation="MNFRNGVSDATLVERSFKTALSFKFPFAIGETLSGLLLFLFNNAT
FT                   IHRLIDVLTARELMEDPHSFVARHLVQLGQVITLSGQRMAALYLLLHGILKLVTLLLLF
FT                   RKKLWAYPLSILLFIGFIGYQIREFLATHHISMIALTLFDLLMIVLTYLEYKELKNVLN
FT                   SSLKALKHSFSPK"
FT   misc_feature    order(293168..293236,293363..293422,293435..293488,
FT                   293501..293569)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0301 by TMHMM2.0 at aa 20-42, 85-104, 109-126 and
FT                   131-153"
FT   CDS             293664..294365
FT                   /transl_table=11
FT                   /locus_tag="SUB0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40855"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH5"
FT                   /protein_id="CAR40855.1"
FT                   /translation="MRQEMLFHTKSGHHIYYEVHGKGKAMVCFHGNGQSVSYFKPQLPL
FT                   AAAFQLILIDTPGHGQSSPLKEKLTFAAIATEVKELLDSLDLEDYVLVGHSDGANLAIA
FT                   FENVYPKKVSGMLLNAGNISFTGLKAHSVFSISLKVIKLALHSLFNPKLKNAYHVAWLI
FT                   MANQTIIPSSYSNQIPVYVLVGEKDMIRANHSLAIAKHYDKGRLITLPYMGHNINKKPE
FT                   VFNHIILELEK"
FT   misc_feature    293808..294353
FT                   /locus_tag="SUB0302"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 0.0054"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS             294530..295513
FT                   /transl_table=11
FT                   /locus_tag="SUB0303"
FT                   /product="LacI family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40857"
FT                   /db_xref="GOA:B9DTH6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH6"
FT                   /protein_id="CAR40857.1"
FT                   /translation="MNRKSFTMKDVAKRAGVSVGTVSRVINQESGIKKVTLEKVTKAIA
FT                   ELNYVPDNYARGMKTNRTETVALIVPTIWHPFFSEFAFYIEKELSNINYKLLLCNTDGV
FT                   KKEIEYINMLQQNKVDGIIAITYSPIEDYLATNIPFVSIDRSYGNKDIPWVSSDNYAGG
FT                   QKAAEVLVENGCKNLLFVGSHNQTINETKNRRNGFEDFLRDKGVHFSSFDLEEPIENFN
FT                   EQLYEYLAEHLEIDGIFAINDFTALDIIDALAKLGKNVPHDVQIIGYDGIKFAKEKSFP
FT                   VSTIKQPLKEMAQEAVRIVLSIIENEPHKLQVTLPISYIDGPTTKK"
FT   misc_feature    294545..294622
FT                   /locus_tag="SUB0303"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.9e-11"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    294545..294610
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2281.000, SD 6.96 at aa 6-27, sequence
FT                   FTMKDVAKRAGVSVGTVSRVIN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    294551..294607
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    294716..295498
FT                   /locus_tag="SUB0303"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   CDS             295676..296593
FT                   /transl_table=11
FT                   /locus_tag="SUB0304"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40858"
FT                   /db_xref="GOA:B9DTH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH7"
FT                   /protein_id="CAR40858.1"
FT                   /translation="MKREAKKNSFLDRVKRQKLLLLMLLPGLILTFVFKYIPMYGVLIA
FT                   FKDYNPLLGILKSPWVGFLEFRHFLASPNFSILLFNTIKLSVYGLLLGFLPPVFLAIML
FT                   NQLMSEKAKKRIQLILYAPNFISVIVIVGMIFLFFSVEGPVNDFLKIFGMKTDFMTNPG
FT                   YFRPLYILSGIWQGMGWASTLYTATLVNVDTSLIEAAQLDGANIFQRIRHIDLPALKPI
FT                   MVIQFILAAGNIMNVGYEKAFLMQTSLNLPTSEIISTYVYKVGLVSGDYSYSTAVGLFN
FT                   SVINMILLFSVNKFVEKINDGEGI"
FT   misc_feature    order(295733..295801,295928..295996,296030..296098,
FT                   296177..296245,296321..296389,296486..296554)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0304 by TMHMM2.0 at aa 20-42, 85-107, 119-141, 168-190,
FT                   216-238 and 271-293"
FT   misc_feature    295910..296578
FT                   /locus_tag="SUB0304"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.00018"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    296240..296326
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             296601..297488
FT                   /transl_table=11
FT                   /locus_tag="SUB0305"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40860"
FT                   /db_xref="GOA:B9DTH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH8"
FT                   /protein_id="CAR40860.1"
FT                   /translation="MNTNLYSDFDKRILIINKIIIAFLVLITVLPMGYILIASFMDPQV
FT                   LANQGISLNPQDWTVDGYKRVLGDNAILRGFINSLIYSTAFAVLTVIISVLTAYPLSKK
FT                   DLVGRRWINYFLIFTMFFGGGLVPTYLLIKNLGMLNTMWSIIVPGAVNVWNIILARTYF
FT                   QGLPDELVEAAVIDGANDFQIFLKIMLPLAKPIMFVLFLYAFVGQWNSYFDAMIYIKDP
FT                   NLAPLQLVLRNILIQSEVSQNMIGAQAAMNEMKKIAEMIKYATIIISSLPLIVMYPFFQ
FT                   KYFDKGIMAGSLKG"
FT   misc_feature    order(296637..296705,296826..296894,296931..296999,
FT                   297150..297218,297381..297440)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0305 by TMHMM2.0 at aa 13-35, 76-98, 111-133, 184-206
FT                   and 261-280"
FT   misc_feature    296826..297470
FT                   /locus_tag="SUB0305"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7.2e-13"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    297087..297173
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             297524..299143
FT                   /transl_table=11
FT                   /locus_tag="SUB0306"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40862"
FT                   /db_xref="GOA:B9DTH9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTH9"
FT                   /protein_id="CAR40862.1"
FT                   /translation="MKKRWIASSVIVLASTIVLGACGSKNTVSSPDYELKKVSFPLKDK
FT                   VTLKFMTSSSTLAPKDPNQKLILKRLEKETGVKIEWTNYQSDFAEKRNLDISSGDLPDA
FT                   IHNDGASDVELMSWAKQGVIVPVEDLIKKYMPNLQKVLDEKPEYKSMITAPDGHIYSFP
FT                   WIEELGEGKESIHSVNDMAWINKAWLDKLGLKMPQTTDELVKVLEAFKTQDPNGNGKAD
FT                   EIPMSFINKPGNEDFKVLFGSFGEGDNDDHLIVSNDNKVDFTADNDSYKEGVAFMRSLQ
FT                   EKGLIDSEAFEQDWNTYIAKGGEDLYGVYFTWDKNNISKNKGDYEVLPVLAGPSGQKNV
FT                   TRTNNVGFSRDRMVITSANKNLELTAKWIDQQYAPLQSVQNNWGTYGDKKQQNIFAFDK
FT                   NQKMLKHLPLEGTAPTEIRQKTEVGGPLAILDSYYGKVTTMPDDAKWRLDILKENYVPY
FT                   MKNESIYPKIFMKEKDLDKIAQIEADMNDYIARKRAEWITKGGIDKEWESYKKELERYG
FT                   LTEWLTIKQKYYDDYVKTKDKE"
FT   sig_peptide     297524..297613
FT                   /locus_tag="SUB0306"
FT                   /note="Signal peptide predicted for SUB0306 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.516 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    297539..298660
FT                   /locus_tag="SUB0306"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 4.3e-10"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   misc_feature    297557..297589
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             299147..300520
FT                   /transl_table=11
FT                   /locus_tag="SUB0307"
FT                   /product="beta-fructofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40865"
FT                   /db_xref="GOA:B9DTI0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI0"
FT                   /protein_id="CAR40865.1"
FT                   /translation="MIEKTFTVERANHFIDKNQSMVIDTYKPDVHFTAPVGWINDPNGF
FT                   VYFRGEYHLFYQYYPYDSVWGPMHWGHAKTKNFIDWENLPVALAPDMPYDKDGCFSGSA
FT                   FVKDDTLWIMYTGNIIDEVNGNKQVQNIAFSKDGVNFEKIATNPVATGDILPDTIVKSD
FT                   FRDPKLFEKDGRFYAVVAAQHKDNVGCIVLLGSENLIEWSFESILLKGNHSQGVMWECP
FT                   DYFEMNGHSYLILSPMKYPKDGLHFSNLNSSIIMKGTVDWEQKQFHVTSVQELDQGHDF
FT                   YAPQTLIDDKGRRVMIAWMHTWGRRVVTHDFKHHWSGQMTMPRILCDEKGIVKQKLPEE
FT                   IMANLPTLSLNNVVKNAGVLSLDGDKSHHFILGNDDDYISFGYDDLKELVYIDRSQQAI
FT                   IITGEEDWDTNMKAAEIKASKLDIIIDKNTIEIFVNDGEATLSSTYFIQKQPILQEKV"
FT   misc_feature    299237..300457
FT                   /locus_tag="SUB0307"
FT                   /note="HMMPfam hit to PF00251, Glycosyl hydrolases family,
FT                   score 6.4e-96"
FT                   /inference="protein motif:HMMPfam:PF00251"
FT   CDS             300535..301410
FT                   /transl_table=11
FT                   /gene="scrK2"
FT                   /locus_tag="SUB0308"
FT                   /product="fructokinase 2"
FT                   /EC_number="2.7.1.4"
FT                   /note="Similar to SUB1542, 69.310% identity (69.310%
FT                   ungapped) in 290 aa overlap (1-290:4-293)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40867"
FT                   /db_xref="GOA:B9DTI1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI1"
FT                   /protein_id="CAR40867.1"
FT                   /translation="MYASIEAGGTKFVCAIGNDNLEIIEKTQFATTTPEETLKKTIEFL
FT                   KPFEKLLQSISIGSFGPIDVDKNSPTYGYITSTPKKHWSNVNLVGCLKEAFDLPIYFTT
FT                   DVNASAYGEMISRQKINNLVYYTIGTGIGAGAIQDGQFVGGLGHTEAGHTYVMSHPTDI
FT                   ENGFTGVCPFHTGCLEGMAAGPSLEARTGIRGELISKDSPVWDIQAFYIAQAAIQATML
FT                   YRPQVIVVGGGVMAQEHMVERVHRQFETLLNGYLPVPDLKSYIVTPAIENNGSATIGNI
FT                   ALAKSLVKNT"
FT   misc_feature    300544..301095
FT                   /gene="scrK2"
FT                   /locus_tag="SUB0308"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 1.9e-73"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   misc_feature    300916..300993
FT                   /note="PS01125 ROK family signature."
FT                   /inference="protein motif:Prosite:PS01125"
FT   CDS             301593..303050
FT                   /transl_table=11
FT                   /locus_tag="SUB0309"
FT                   /product="6-phospho-beta-glucosidase 2"
FT                   /EC_number="3.2.1.86"
FT                   /note="Similar to SUB0837, 51.943% identity (53.249%
FT                   ungapped) in 489 aa overlap (3-484:4-487); and SUB0834,
FT                   45.090% identity (47.569% ungapped) in 499 aa overlap
FT                   (4-485:6-495); and SUB0841, 48.041% identity (49.786%
FT                   ungapped) in 485 aa overlap (4-485:6-476); and SUB0200,
FT                   47.689% identity (49.241% ungapped) in 476 aa overlap
FT                   (4-477:7-469); and SUB1579, 46.856% identity (49.784%
FT                   ungapped) in 493 aa overlap (4-484:9-484); and SUB0905,
FT                   45.155% identity (47.198% ungapped) in 485 aa overlap
FT                   (7-485:11-480)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40868"
FT                   /db_xref="GOA:B9DTI2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI2"
FT                   /protein_id="CAR40868.1"
FT                   /translation="MAIFRDDFLWGGAIAANQVEGAWNLDGKGMSVADVASFKPHLDVK
FT                   DYAGHNKVTSQMIEEAMAAGDSKDYPKRRGIDFYHHYEEDIALFAEMGFKALRLSIAWT
FT                   RLYPTGEESEPNPEGIAFYKRVFECLKAHGIQPIVTLSHYEMPLHLSVTYNGWVDRSII
FT                   DHFVRFAETCFREFGDYVTYWLTFNEVDSVGRHPFTTAGIIPDRCTDYSLEEAVYQALH
FT                   HQYVAAALATKKMRQLIPGSHMGCMLTKLTTYPNTCHPNDVLLSLSKNLENYAHSDVQI
FT                   FGCYPRLYQHFLASKGIRIKAERGDHAILAEGKADYLAFSYYMSRTESADPTKEQVAGN
FT                   TIMSVKNPYLASTDWGWQIDPVGLRISLLELYDRYQIPLMIVENGMGALDHLEEDGKIH
FT                   DSYRIDYLREHIVEMAKAVEMGVDLLGYTSWAPIDLISVSTSQMSKRYGYIYVDQDDLG
FT                   QGSLERYRKDSFYWYQKVIQSNGEDLE"
FT   misc_feature    301593..303038
FT                   /locus_tag="SUB0309"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase family,
FT                   score 1.1e-133"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   misc_feature    301614..301658
FT                   /note="PS00653 Glycosyl hydrolases family 1 N-terminal
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00653"
FT   CDS             303177..303878
FT                   /transl_table=11
FT                   /locus_tag="SUB0310"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40870"
FT                   /db_xref="GOA:B9DTI3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI3"
FT                   /protein_id="CAR40870.1"
FT                   /translation="MTKRPIIGITGNESKGKESWENGITRTYTSKIFSDIIMESGGLPI
FT                   VLPIAHPDFVEDYVASIDKLMLTGGQHVLPHFYGEKRSIQSDDYNEARDLYELRLVEET
FT                   LKQGKPILGICRGLQLVNVALGGSLNQMVANHWHETAPSRGHQTIRIADQSILHDIFGD
FT                   YHDVNSLHLQSIKTLATDLEAIAWDSNDQTIEAVISRRHAILGLQWHPELMVRQDPVSQ
FT                   KIFDYFVNEMA"
FT   misc_feature    303189..303812
FT                   /locus_tag="SUB0310"
FT                   /note="HMMPfam hit to PF07722, Peptidase C26, score
FT                   3.5e-81"
FT                   /inference="protein motif:HMMPfam:PF07722"
FT   misc_feature    303336..303869
FT                   /locus_tag="SUB0310"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 2.1e-05"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   CDS             complement(303918..304748)
FT                   /transl_table=11
FT                   /locus_tag="SUB0311"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40872"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI4"
FT                   /protein_id="CAR40872.1"
FT                   /translation="MSQKLLGYQKGNSFFDNLSGASKLIFFILVSVACMTTYDTRLIIV
FT                   IGLLSLFLLKIAKVPWQKISFIITFVSFFAILNVVMVYLFAPSYGERIYHSRTVLFEGM
FT                   GPFYLTLEELFYLVNLSLKYFSTVPLAILFLTTTHPSQFASSLNQIGVPYKVAYAVSLT
FT                   LRYIPDVQEEFFMIRTSQEARGLELSKKAKLLDRIKGNLQILIPLIFSSLERIDTVSTA
FT                   MELRRFGKFKKRTWYKYQAFNLRDGLTVLLAVSLLLVSLLLFYLNKGRFYNPFL"
FT   misc_feature    complement(order(303951..304010,304341..304409,
FT                   304491..304559,304578..304631,304644..304712))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0311 by TMHMM2.0 at aa 13-35, 40-57, 64-86, 114-136 and
FT                   247-266"
FT   misc_feature    complement(304038..304718)
FT                   /locus_tag="SUB0311"
FT                   /note="HMMPfam hit to PF02361, Cobalt transport protein,
FT                   score 4.2e-21"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   misc_feature    complement(304092..304121)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS             complement(304714..306417)
FT                   /transl_table=11
FT                   /locus_tag="SUB0312"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40874"
FT                   /db_xref="GOA:B9DTI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI5"
FT                   /protein_id="CAR40874.1"
FT                   /translation="MTNLITFNNFSFTYDAQSEPTLKNIQLTIEKGQKVLIIGPSGSGK
FT                   STLGNCLNGIIPNHFSGTHQGELVINQQDAFDLSIYDKSKLVSTVLQDPDGQFIGLSVA
FT                   EDIAFALENDCIQQSEMQSTVSTWAERLELADYLEHRPQDLSGGQKQRVSLAGVLVDES
FT                   PILLFDEPLANLDPKTGLDTIDLIDKLHQKTEATTIIIEHRLEEVLYRPVDKVILINDG
FT                   RILFDGSPDQLLATDLLAQNGIREPLYLTCLKDLGFKVSDQEPLSQLDALNLTGLELTN
FT                   KRSDSPKEEKKILLDIRHLNFAYQADQPILKEINLQIGQGERLAIVGQNGAGKSTLAKV
FT                   LCRFLESDASILYKDNDISADSIKERADRIGYVLQNPNQMISQTMLFDEVAQGLRLRGI
FT                   SEDEVTEKVEQTLKVCGLFPFRNWPISALSFGQKKRVTIAAILVLNPEIIVLDEPTAGQ
FT                   DKKHYSEMMAFLDHLNQEGHTIIMITHDMQLMLEHCDRTLVLSQGQIIADDQPQAILSD
FT                   ADILEKAYLKKTSLFHLAEKLHCSPLDLTDYYITMERKRHVTETPWLSEG"
FT   misc_feature    complement(304909..305457)
FT                   /locus_tag="SUB0312"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.5e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(305092..305136)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(305413..305436)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(305752..306324)
FT                   /locus_tag="SUB0312"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-39"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(305941..305985)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(306280..306303)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(306430..306975)
FT                   /transl_table=11
FT                   /locus_tag="SUB0313"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40876"
FT                   /db_xref="GOA:B9DTI6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTI6"
FT                   /protein_id="CAR40876.1"
FT                   /translation="MKNTSIKTVVAIGIGAALFVIIGLFVPITIFTNTTISLQYAVQAL
FT                   FSVLFGPVAGFFIGFIGHMLKDMFAGYGVWWSWVLPSGLVGLGIGSLKNRLKVDKGIFS
FT                   KKDILSFNLVQALVNLISWAIVAPLGDILIYQEPANKVFTQGLFAAFANTFTIGIGGTL
FT                   LLIAYANSRPKAGSLRKD"
FT   misc_feature    complement(306433..306969)
FT                   /locus_tag="SUB0313"
FT                   /note="HMMPfam hit to PF07155, Protein of unknown function
FT                   (DUF1393), score 1.7e-115"
FT                   /inference="protein motif:HMMPfam:PF07155"
FT   misc_feature    complement(order(306469..306537,306574..306642,
FT                   306700..306768,306787..306855,306883..306951))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0313 by TMHMM2.0 at aa 9-31, 41-63, 70-92, 112-134 and
FT                   147-169"
FT   sig_peptide     complement(306880..306975)
FT                   /locus_tag="SUB0313"
FT                   /note="Signal peptide predicted for SUB0313 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.947) with cleavage site
FT                   probability 0.798 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(306987..307832)
FT                   /transl_table=11
FT                   /locus_tag="SUB0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40878"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI7"
FT                   /protein_id="CAR40878.1"
FT                   /translation="MSNNLLVLQSDFGLVDGAVSAMIGVALQENPSLGIHHLTHDITPY
FT                   NIFEASYRLFQTIEYWPEGTTFVSVVDPGVGSKRKSVVALTANNHYIVTPDNGTLSYIK
FT                   KHIGIKAIREISEAKNRRQNTELSYTFHGRDVYAFTGAKLASGHITFEEVGPELSVDAI
FT                   VEVPVVDTTIEDDGIVGVIDILDVRFGSLWTSITREEFLHLTPEFGDRFEVTIYNNDML
FT                   VYQNQVTYGKSFADVRIGQPIIYINSLYRVGIAINQGSFAKAYNVGVGQNWHVAIKKIA
FT                   "
FT   misc_feature    complement(306999..307820)
FT                   /locus_tag="SUB0314"
FT                   /note="HMMPfam hit to PF01887, Protein of unknown function
FT                   DUF62, score 2.5e-79"
FT                   /inference="protein motif:HMMPfam:PF01887"
FT   CDS             308008..308826
FT                   /transl_table=11
FT                   /locus_tag="SUB0315"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40880"
FT                   /db_xref="GOA:B9DTI8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI8"
FT                   /protein_id="CAR40880.1"
FT                   /translation="MYKLIAFDMDGTLLQSDKSIAETSLSSIKDAFQNGKEVVLATGRP
FT                   KSELHMYQKELSNIRYGILESGAIVYDFVNDKVLMKEVIPKDISDKVYDIVQTNDVMVV
FT                   LMIDGQGYIQQDHFDHIADYHMSIYEDLYQDSAIFLDEILPKMETEAGQFEKINLYFKT
FT                   NVLRDHYYKVLSNENVTLAKAEETAIEITARGVEKGQGLKKLCQILGYSIVEAIAVGDA
FT                   DNDESMIRDAGLGVAMANANQNIKKLADVIVSSNDNGGIQEVIEKFLLKS"
FT   misc_feature    308011..308733
FT                   /locus_tag="SUB0315"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 2.3e-11"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    308662..308730
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   rRNA            309114..310657
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            310729..310801
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:310762..310764,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            310996..313894
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            314097..314239
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            314220..314293
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:314254..314256,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 74.15"
FT   tRNA            314363..314436
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:314397..314399,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 69.55"
FT   CDS             complement(314502..315851)
FT                   /transl_table=11
FT                   /locus_tag="SUB0316"
FT                   /product="putative aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40882"
FT                   /db_xref="GOA:B9DTI9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTI9"
FT                   /protein_id="CAR40882.1"
FT                   /translation="MKVAKFGGSSLASANQLKKVFNIVASDSERKIIVVSAPGKQDPKD
FT                   TKITDALITYHDTFVTGGDVRQIQNWIIKRYQDIAEDLDIHNKIMEQIKESILSLTENQ
FT                   IEDNPFLYDTFLAAGEDNNAKLVAEYFRSNGLMARYMHPKTAGLFVTGEPQNARILPSS
FT                   YDKLEKLKEYEGVLVIPGFFGITAEGDICTFSRGGSDITGSLIAAAVGAELYENFTDVD
FT                   GIFAAHPGVVDKPHSIKELTYKEMRELAYAGFTVLHDEALIPAYRGKIPLVIKNTNNPD
FT                   HPGTKIVLERKENQSPVVGISGDDKFVSINIAKYLMNREVGFGRKVLQILEDLNIRWEH
FT                   MPTGIDDLSIVIREHELTPIKQDEIVNQLVHNIEVDQLSITKDLSIIMIVGENMKSHIG
FT                   VTATAAKALSDNQINITMMSQGSSEFSIMFVVKSKDEKKAIKALYDAFFK"
FT   misc_feature    complement(314514..314699)
FT                   /locus_tag="SUB0316"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 4.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   misc_feature    complement(315024..315851)
FT                   /locus_tag="SUB0316"
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family,
FT                   score 2.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   misc_feature    complement(315819..315845)
FT                   /note="PS00324 Aspartokinase signature."
FT                   /inference="protein motif:Prosite:PS00324"
FT   CDS             316002..316754
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SUB0317"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40884"
FT                   /db_xref="GOA:B9DTJ0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTJ0"
FT                   /protein_id="CAR40884.1"
FT                   /translation="MTRYKAIISYDGSQFQGFQRQSHARSVQEEIEKTLTKLTNGKEIK
FT                   VHGAGRTDSGVHAYGQVLHFDLDQDRDLEKLRFALDTQSPEDIDFISVEKVSDDFHSRY
FT                   TKHLKTYEFIVDIGRPKNPMMRHYATHFPYPLDLDNIQLAIKDLIGTHDFTGFTASGAT
FT                   IENKVRTIIDASVRYEEDKNFLIFTFTGNGFLYKQVRNMVGTLLKIGNNRMPVDQIKTI
FT                   LEKKDRQLAGPTPAGNGLYLKEIIYEDK"
FT   misc_feature    316017..316316
FT                   /gene="truA"
FT                   /locus_tag="SUB0317"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 1.2e-35"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   misc_feature    316431..316745
FT                   /gene="truA"
FT                   /locus_tag="SUB0317"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 3.6e-28"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   CDS             316741..317508
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SUB0318"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40887"
FT                   /db_xref="GOA:B9DTJ1"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ1"
FT                   /protein_id="CAR40887.1"
FT                   /translation="MKTNNILAISGNDIFSGGGLYADLNTFAHYQLHGFLTVTCLTAMT
FT                   KSGFEVFGIDKAVFKQQLDSLKTVPFEAIKIGLLPNVELAEITLDFIKGHTDIPVILDP
FT                   VLVCKEKQDVAVSQLRDELLKFFPYVTLITPNLVEAELLAQKKIRTVDDMKLAAQKLYA
FT                   LGARQVVIKGGNRLSQEMAIDLYYDGTEFTILESAILEENNIGAGCTFASGIASQLALG
FT                   ISPLDAVRESKSFVYQAILHSDQYGVKQIYDEN"
FT   CDS             317495..317962
FT                   /transl_table=11
FT                   /locus_tag="SUB0319"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40888"
FT                   /db_xref="GOA:B9DTJ2"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ2"
FT                   /protein_id="CAR40888.1"
FT                   /translation="MMKTKTSQMTLLSILTALTIILGKFVSIGTPTGFLTLLDAGIYFT
FT                   AFYLGKKEGMIVGGLSGFLIDLISGYPNWMFFSLIAHGAQGYFAGMTGKQRPLGIILAS
FT                   LAMVATYFVATIPMYGMGAAISSLLGNVCQNLLGMIVGYLLYISFSKVKKA"
FT   misc_feature    order(317531..317599,317657..317725,317786..317854,
FT                   317867..317935)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0319 by TMHMM2.0 at aa 13-35, 55-77, 98-120 and 125-147"
FT   CDS             317981..318547
FT                   /transl_table=11
FT                   /locus_tag="SUB0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40889"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ3"
FT                   /protein_id="CAR40889.1"
FT                   /translation="MISLIDLKVETQAIVVDIVERSGIKKGQVFVLGLSSSEVLGAKIG
FT                   KNSSLEVGEVIVETILKVLREKGIHLAVQGCEHINRALVVEEAVAEDKGFEIVNVLPSL
FT                   HAGGSGQLAAFKLMEHPVEVEDIVAHAGLDIGDTSIGMHVKKVQVPLVPIQRELGGAHV
FT                   TALASRPKLIGGARALYQSDSIRKN"
FT   misc_feature    318005..318520
FT                   /locus_tag="SUB0320"
FT                   /note="HMMPfam hit to PF04260, Protein of unknown function
FT                   (DUF436), score 3.3e-113"
FT                   /inference="protein motif:HMMPfam:PF04260"
FT   CDS             complement(318623..319465)
FT                   /transl_table=11
FT                   /locus_tag="SUB0321"
FT                   /product="mechanosensitive ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40890"
FT                   /db_xref="GOA:B9DTJ4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ4"
FT                   /protein_id="CAR40890.1"
FT                   /translation="MTFIMNYLEHLQLEEILVTLFSKVISLILLLLFFAILKQLTNRFF
FT                   EKAILKSFSFSRQSQARKNTLTKLIHNLLNYFLYFLLIYWVLSLLNVPVSSLLAGAGIA
FT                   GVAIGLGAQGFLSDVVNGFFILFENQFEVGDNVSIASIEGTISSVGIRTTQVRGYDGTL
FT                   HFIPNRSITVVSNKSRGNMRALIEIPLYSTTNLEKVSDIIESVNKREVSHFPEIIDKPN
FT                   VLGPQIATNGQFSFRIAIFTENGQQYHIYHTFYKLYQEALLKEGIELPTSNTIHTTAK"
FT   misc_feature    complement(318656..319252)
FT                   /locus_tag="SUB0321"
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel, score 5.8e-51"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   misc_feature    complement(order(319085..319153,319181..319249,
FT                   319355..319423))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0321 by TMHMM2.0 at aa 15-37, 73-95 and 105-127"
FT   CDS             319734..321017
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SUB0323"
FT                   /product="trigger factor (prolyl isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40892"
FT                   /db_xref="GOA:B9DTJ5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTJ5"
FT                   /protein_id="CAR40892.1"
FT                   /translation="MSTSFENKATNRGVITFTIGQDKIKPALDQAFNKIKKDLNVPGFR
FT                   KGHLPRPIFNQKFGEEVLYEDALNIVLPAAYEAAVAELDLAVVAQPKIDVVSMEKGKDW
FT                   EISAEVVTKPEVKLGEYKDLAVEVEASKEVTDEEVDAKIERERQNLAELVVKEDAAVEG
FT                   DTVVIDFVGSVDGVEFDGGKGENFSLELGSGQFIPGFEDQLVGTKAGETKNVEVTFPED
FT                   YQAEDLAGKAATFVTTVHEVKSKEVPALDDELAKDIDEEVETLDELKAKYRKELEAAKE
FT                   IAFDDAVEGAAIELAVANAEIVELPEEMVHDEVHRAMNEFMGNMQRQGISPEMYFQLTG
FT                   TTQEDLHKQYESEADKRVKTNLVIEAIAKAEGFEATDEEIEKEINDLATEYNMPVEQVR
FT                   TLLSADMLKHDIAMKKAVEVITETVKVK"
FT   misc_feature    319734..320192
FT                   /gene="tig"
FT                   /locus_tag="SUB0323"
FT                   /note="HMMPfam hit to PF05697, Bacterial trigger factor
FT                   protein (TF), score 1.4e-62"
FT                   /inference="protein motif:HMMPfam:PF05697"
FT   misc_feature    320193..320453
FT                   /gene="tig"
FT                   /locus_tag="SUB0323"
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomera, score 1e-27"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    320454..320984
FT                   /gene="tig"
FT                   /locus_tag="SUB0323"
FT                   /note="HMMPfam hit to PF05698, Bacterial trigger factor
FT                   protein (TF) C-ter, score 5.1e-69"
FT                   /inference="protein motif:HMMPfam:PF05698"
FT   misc_feature    320877..320942
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1032.000, SD 2.70 at aa 382-403, sequence
FT                   KEINDLATEYNMPVEQVRTLLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             321091..321792
FT                   /transl_table=11
FT                   /locus_tag="SUB0324"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40895"
FT                   /db_xref="GOA:B9DTJ6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ6"
FT                   /protein_id="CAR40895.1"
FT                   /translation="MLKAVIFDMDGVIVDTEYIDFQLQSDFIKSIAKHPEQLTHHDFSQ
FT                   LVGRSGRDLLERIQSLCQSDISFAEIYKGFDAINDQKYSQEMIKTHFRKDIVKIIEFAK
FT                   KHGIALAIASSSSKQHILKVLKTCRIDDAFNLIVSGEDFKESKPNPAIYQFVLRQLDIH
FT                   ASEAIVIEDSPSGIAAAKSAGIPVIAYEEKRMLVDQSQANIILPNMQAISEKIMKIVQE
FT                   EKNFTEKNFDE"
FT   misc_feature    321094..321669
FT                   /locus_tag="SUB0324"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 2.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS             321842..322408
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SUB0325"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40896"
FT                   /db_xref="GOA:B9DTJ7"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTJ7"
FT                   /protein_id="CAR40896.1"
FT                   /translation="MKLDIFAGQEKSELSMIEVARAILEERGRDNEVYFSDLVNDIQTF
FT                   LGKSDADIRQALPFFYTDLNTDGSFIPLGDNKWGLRSWYAIDEIDEEIITLEDEEDGAP
FT                   KRKKKRVNAFMDGDEDAIDYSDDDPEDEDFTEETSDVEYDEEDPDDEKSEVESYDSELN
FT                   EIIPEDDIEEVEINEEDDEDDEEEE"
FT   misc_feature    321842..322405
FT                   /gene="rpoE"
FT                   /locus_tag="SUB0325"
FT                   /note="HMMPfam hit to PF05066, DNA-directed RNA polymerase
FT                   delta subun, score 1e-99"
FT                   /inference="protein motif:HMMPfam:PF05066"
FT   CDS             322678..324282
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SUB0326"
FT                   /product="putative CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40898"
FT                   /db_xref="GOA:B9DTJ8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ8"
FT                   /protein_id="CAR40898.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEAVEQGIK
FT                   NKLAQFCDVQPEAVIESRDVEHLYQIPLNLQAQGMDQIVCDHLKLDVPQADMTEWTAMV
FT                   DKVMNLKKTTKIALVGKYVELPDAYLSVVEALKHSGYENDAAIDLNWVNANDVTEETVA
FT                   SLLGDADGIIVPGGFGQRGTEGKIQAIRYAREQDVPMLGICLGMQLTCIEFARHVLNLE
FT                   GANSSELDPTTQYPIIDLMRDQIDIEDMGGTLRLGLYPCKLKAGSKAAAAYDNQEVVQR
FT                   RHRHRYEFNTKFRQEFEQAGFVFSGVSPDNRLMEIVELPEKKFFVAAQYHPELHSRPNH
FT                   AEELYTAFISAAIANQN"
FT   misc_feature    322681..323514
FT                   /gene="pyrG"
FT                   /locus_tag="SUB0326"
FT                   /note="HMMPfam hit to PF06418, CTP synthase N-terminus,
FT                   score 3.6e-216"
FT                   /inference="protein motif:HMMPfam:PF06418"
FT   misc_feature    323578..324261
FT                   /gene="pyrG"
FT                   /locus_tag="SUB0326"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 1e-68"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   CDS             join(324340..324975,324979..325080)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0327"
FT                   /product="sensor histidine kinase (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Staphylococcus aureus (strain MW2) sensor protein
FT                   LytS UniProt:LYTS_STAAW (584 aa) blastp scores: E()=3e-51.
FT                   CDS contains a nonsense mutation (ochre) after codon 212"
FT   misc_feature    324448..324756
FT                   /locus_tag="SUB0327"
FT                   /note="HMMPfam hit to PF07694, 5TMR of 5TMR-LYT, score
FT                   1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF07694"
FT   CDS             325081..325182
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0327A"
FT                   /product="antiholin-like protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Staphylococcus epidermidis antiholin-like protein
FT                   LrgB UniProt:LRGB_STAEP (EMBL:AE016750) (233 aa) fasta
FT                   scores: E()=1.5e-05, 67.647% id in 34 aa"
FT   CDS             325249..326172
FT                   /transl_table=11
FT                   /locus_tag="SUB0329"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40902"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTJ9"
FT                   /protein_id="CAR40902.1"
FT                   /translation="MKIVRLSKYLMLLFLVFSVISVGASFYFFHVAQIREEKSFINTKK
FT                   RGKEDPLYDKEKAFDALKVEERVMYNRGKRQVAWYLPAAQKSHKTAVVVHGFLNSKAGM
FT                   KPYAMLFHDLGYNVLIPDNEAHGQSQGQIIGYGWNDRENVIAWTKELIREDEASRISYF
FT                   GLSMGAATVMMASGEKLPKQVVNIIEDCGYSSVWDELKYQAKAMYNLPAFPILYEVSAI
FT                   SKLRAGFTYKEASSVKQLQKNKLPVLFIHGDKDDFVPTQMVYDNYKATRGPKELLIIKG
FT                   AKHAEAYKVNMKEYQEKIKDFLKKYQ"
FT   sig_peptide     325249..325320
FT                   /locus_tag="SUB0329"
FT                   /note="Signal peptide predicted for SUB0329 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.958 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    325282..325350
FT                   /note="1 probable transmembrane helix predicted for SUB0329
FT                   by TMHMM2.0 at aa 12-34"
FT   tRNA            326229..326314
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:326263..326265,aa:Leu)"
FT                   /note="tRNA Leu anticodon AAG, Cove score 52.47"
FT   CDS             326493..327374
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SUB0330"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40904"
FT                   /db_xref="GOA:B9DTK0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK0"
FT                   /protein_id="CAR40904.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVCQSLISNLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKTKEVVALAHAKGVSVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPENWEGLALDHLEKLAAAVPGFPIVLHGGSGIPDDQIKAAI
FT                   KLGVAKVNVNTESQIAFSDATREFARNFEANEAEYTGKKLFDPRKFLAPGMKAVQGAVE
FT                   ERIDVFGSANKA"
FT   misc_feature    326499..327371
FT                   /gene="fba"
FT                   /locus_tag="SUB0330"
FT                   /note="HMMPfam hit to PF01116, Fructose-bisphosphate
FT                   aldolase class-II, score 1.3e-109"
FT                   /inference="protein motif:HMMPfam:PF01116"
FT   misc_feature    326712..326753
FT                   /note="PS00602 Fructose-bisphosphate aldolase class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00602"
FT   misc_feature    326889..326924
FT                   /note="PS00806 Fructose-bisphosphate aldolase class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00806"
FT   CDS             327598..327786
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SUB0331"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40906"
FT                   /db_xref="GOA:B9DTK1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTK1"
FT                   /protein_id="CAR40906.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTILVDGKPK
FT                   KVWASARALKSGKVERV"
FT   misc_feature    327604..327780
FT                   /gene="rpmB"
FT                   /locus_tag="SUB0331"
FT                   /note="HMMPfam hit to PF00830, Ribosomal L28 family, score
FT                   2.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00830"
FT   CDS             327925..328290
FT                   /transl_table=11
FT                   /locus_tag="SUB0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40908"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK2"
FT                   /protein_id="CAR40908.1"
FT                   /translation="MTVKINTKDGLIELSDDVIATVVGGSATEIFGVVGMASKSALKDN
FT                   FQSLLRKENYAKGVVVKATDMGISVDVYTVMSYGVKISEVSKNIQERVKFNLESQLGLT
FT                   ADMVNVYVQNIKVVGEN"
FT   misc_feature    327946..328272
FT                   /locus_tag="SUB0332"
FT                   /note="HMMPfam hit to PF03780, Protein of unknown function
FT                   (DUF322), score 4.6e-53"
FT                   /inference="protein motif:HMMPfam:PF03780"
FT   CDS             328290..329957
FT                   /transl_table=11
FT                   /locus_tag="SUB0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="Possible alternative translational start site after
FT                   codons 7 and 11"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40909"
FT                   /db_xref="GOA:B9DTK3"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK3"
FT                   /protein_id="CAR40909.1"
FT                   /translation="MSKITASLLQEMVQAAATRLGKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTMDNGAKEVADKPADTVGEVGQILSKGLLMGARGNSGVITSQIFRGFGQSIKGKTELD
FT                   GKDLALALQSGVEVAYKAVMKPVEGTILTVARGAASAALKKSDSTNDAVEVMASALKGA
FT                   KKALAKTPELLPVLKEVGVVDSGGQGLVFIYEGFMSALNGDYVASEDFKATPANMAEMI
FT                   NAEHHKAVVGHVATEDITYGYCTEIMVALRQGPTYVKEFNYEEFQGYLSNLGDSLMVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHDAQVEKTNIATKPQEEAKEF
FT                   GLIAVVAGQGLADIFKAQGVDYIISGGQTMNPSTEDIVKAIEAVNAKQVIILPNNKNIF
FT                   MAAQSAAEVVDIPARVVETRTVPQGFTSLLAFDTTKTLDDNVANMTASLSEVTSGSITL
FT                   AVRDTTIDGLEIHENDYLGMVDGKILVSDANLEAALKATFEQMITEDSEIVTIFVGEDG
FT                   EVPLAEELADYLEEKYEDIEVEIHEGNQPVYPYLMSVE"
FT   misc_feature    328389..328886
FT                   /locus_tag="SUB0333"
FT                   /note="HMMPfam hit to PF02734, DAK2 domain, score 6.4e-73"
FT                   /inference="protein motif:HMMPfam:PF02734"
FT   misc_feature    328569..328592
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             330126..331016
FT                   /transl_table=11
FT                   /locus_tag="SUB0334"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40911"
FT                   /db_xref="GOA:B9DTK4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR028512"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK4"
FT                   /protein_id="CAR40911.1"
FT                   /translation="MLYSLIIFSFWAIFALIVIASSLYVVRQQSVAIIERFGKYQKTSQ
FT                   SGIHIRMPFGIDKIAARVQLRLLQTEIIVETKTKDNVFVTLNVATQYRVNENNVTDAYY
FT                   KLMKPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQHQVAEEMSTYGYIIVKTL
FT                   ITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAASAEAEKDRLHGVGIAQQ
FT                   RKAIVDGLAESIQELKDANISLSEEQIMAILLTNQYLDTLNTFASRGNQTIFLPNTPNG
FT                   VDDIRTQVLSALKVK"
FT   misc_feature    330135..330203
FT                   /note="1 probable transmembrane helix predicted for SUB0334
FT                   by TMHMM2.0 at aa 4-26"
FT   misc_feature    330192..330719
FT                   /locus_tag="SUB0334"
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band, score
FT                   4.6e-47"
FT                   /inference="protein motif:HMMPfam:PF01145"
FT   CDS             complement(331083..331199)
FT                   /transl_table=11
FT                   /locus_tag="SUB0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40913"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK5"
FT                   /protein_id="CAR40913.1"
FT                   /translation="MAEKTDLASAYRRLKSPNIKTKKRALKIIHEHKRSGKK"
FT   CDS             complement(331361..332101)
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="SUB0336"
FT                   /product="putative glutamine ABC transporter, ATP-binding
FT                   protein 2"
FT                   /note="Similar to SUB1278, 59.592% identity (59.836%
FT                   ungapped) in 245 aa overlap (1-245:1-244); and SUB1153,
FT                   54.694% identity (54.918% ungapped) in 245 aa overlap
FT                   (1-245:1-244); and SUB1414, 50.607% identity (52.301%
FT                   ungapped) in 247 aa overlap (5-246:1-244)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40915"
FT                   /db_xref="GOA:B9DTK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK6"
FT                   /protein_id="CAR40915.1"
FT                   /translation="MSNPIIEIKHLKKSYGNNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TLLRSINLLEEPTAGEVLFHGNNVLDDNYNLIHYREKLGMVFQSFNLFDNLNVLENAIV
FT                   AQTTVLKRSRQEAEKIAKENLNKVGMTEQYWKAKPKQLSGGQKQRVAIARALSVNPEAM
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMDFAQEVSNRVIFMDKGVIAEE
FT                   GTPQEIFENPKEERTKEFLQRFLK"
FT   misc_feature    complement(331451..332011)
FT                   /gene="glnQ2"
FT                   /locus_tag="SUB0336"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.7e-61"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(331634..331678)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(331967..331990)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(332115..333665)
FT                   /transl_table=11
FT                   /locus_tag="SUB0337"
FT                   /product="glutamine ABC transporter, glutamine-binding
FT                   protein/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40917"
FT                   /db_xref="GOA:B9DTK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK7"
FT                   /protein_id="CAR40917.1"
FT                   /translation="MRKFLMSCFAALLLLFAGVSQADADQYLRVGMEAAYAPFNWTQDD
FT                   NSNGAVPIEGTNQYANGYDVQVAKKVAKSLNKKLLVVKTSWTGLIPALTSGKIDMIAAG
FT                   MSPTEERKKEIAFSDSYYTSEPVIVVKADSKFAKAKSLDDFAGAKITAQQGVWHVNLIP
FT                   QINGVKAQTPMGDFSQMRQALSSGVIDGYISERPEAMTAENANSAFKMVVLKKAFTVNE
FT                   SDAAIAVGMRKDDPRIVQVNTVLADLSANDRLDLMDKMVTLQPKEKKAENGVQPSFLDQ
FT                   MWSIVTKNWKQFLRGTGLTLLISTIGTIVGLIIGLLIGIYRTAPKSKHKVLAFFQKLFG
FT                   WFLNVYIEVFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMTEIVRGG
FT                   IFAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQNYQYFQTFSVIAVIYFILTFTVTRILRYVERRIDDDNYTTTVNELP"
FT   misc_feature    complement(332151..332777)
FT                   /locus_tag="SUB0337"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.1e-27"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(order(332178..332246,332463..332531,
FT                   332574..332642,332703..332771))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0337 by TMHMM2.0 at aa 299-321, 342-364, 379-401 and
FT                   474-496"
FT   misc_feature    complement(332382..332468)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    complement(332877..333584)
FT                   /locus_tag="SUB0337"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding p, score 9.5e-40"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   sig_peptide     complement(333594..333665)
FT                   /locus_tag="SUB0337"
FT                   /note="Signal peptide predicted for SUB0337 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.504 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             333867..335768
FT                   /transl_table=11
FT                   /locus_tag="SUB0338"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40919"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK8"
FT                   /protein_id="CAR40919.1"
FT                   /translation="MKKWFFLFILFLGFFGQNILASEVDYRIPLYEGFLTVNEDNSADF
FT                   RQEVTYIFSSDYNGQYLSLGKAGNMPDGFGIDQNPQVQAYKNGQKVEVSSFLEDLGDGY
FT                   RLKVYNSGQATDKVKIVVTWKLRHLLSKYQDIAVLNWKPISDWDETLETVHFAIKSQKT
FT                   SQEQEMYLHRGYFFPGAHEKGKNQIDMRASKVSGVLEFHGYWDSSIVTGMAENQNYLPK
FT                   FKKTEEAIAKNTRLANNIVNYYIYIVVALLFLLAGFCWYLFKKSVFRYSNHKDERLYAL
FT                   PGDQAPLVIAQKIFHLDLQKLNPSQSILKDDNISFENLVQATLLDLVDRKAIMMEKEDN
FT                   HYYLSLVNDSHLSDFEKAFVRMAFGDQKKLKTDQLFADYFFDSGIEKKLKKQYKGQELQ
FT                   RQVNQRGKEHLDKLDSAFRNLTELVKNHIGTEGDHYYRSMTVKEKIYLGLANAFLVFII
FT                   IILFCLGFYVMAMANGRNLIIDIVLALIAIVGIYQMTKQTSKDLLQGVLTQEGQLARQP
FT                   WDAFIHMLKDIDHFEKAEVESLVVWNRMLVYASMFGFAEQVEKYMILHGIQLEDKNLGR
FT                   QYGSIHPFMYGMTNNLTSSSMAASNASHFSVSSGSSSGGFSGGGFSGGGGGGGGGAF"
FT   sig_peptide     333867..333929
FT                   /locus_tag="SUB0338"
FT                   /note="Signal peptide predicted for SUB0338 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.986) with cleavage site
FT                   probability 0.980 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(334584..334652,335199..335267,335295..335348)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0338 by TMHMM2.0 at aa 240-262, 445-467 and 477-494"
FT   CDS             335838..336677
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SUB0339"
FT                   /product="undecaprenol kinase (bacitracin resistance
FT                   protein)"
FT                   /EC_number="2.7.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40921"
FT                   /db_xref="GOA:B9DTK9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTK9"
FT                   /protein_id="CAR40921.1"
FT                   /translation="MLFFEILKAIFFGVVEGITEWLPISSTGHLILVQEFIKMNQDKDF
FT                   MDMFNIVIQLGAIIAVMVIYFERLNPFQPGKSARQVQLTWQLWLKVVIACVPSAIFGLL
FT                   LDNWMEAHFYNFVVVALMLILYGYAFLWIEKRNEKVEPKVTELSRMSYKTAFLIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRPVAADFTFFLAIPTMFGYSGLKAVKFFLDGNHLAF
FT                   SQILILLVASLTAFVVSMYAIKFLTDYVKKHDFTVFGKYRIALGSVLILYFFVSLFM"
FT   misc_feature    335859..336644
FT                   /gene="bacA"
FT                   /locus_tag="SUB0339"
FT                   /note="HMMPfam hit to PF02673, Bacitracin resistance
FT                   protein BacA, score 4.9e-124"
FT                   /inference="protein motif:HMMPfam:PF02673"
FT   misc_feature    order(335865..335933,335970..336038,336081..336149,
FT                   336168..336236,336279..336347,336366..336434,
FT                   336498..336566,336603..336671)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0339 by TMHMM2.0 at aa 10-32, 45-67, 82-104, 111-133,
FT                   148-170, 177-199, 221-243 and 256-278"
FT   CDS             336792..337550
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="SUB0340"
FT                   /product="adapter protein MecA"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40923"
FT                   /db_xref="GOA:B9DTL0"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTL0"
FT                   /protein_id="CAR40923.1"
FT                   /translation="MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYTVM
FT                   DELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSDLNKEINFDDLADLGDVSQMTPEDFF
FT                   KTIEKSMIEKGDVNAHEKLEKIEEMMEEAVDAVMTQNAEEQKEEESPFEPLDYVHYVLD
FT                   FMTIQDAITFSKTVTFPIEASELYKSSDRYHMTILLDIQNQPSYYANVMYARLIEHALP
FT                   GSKTRAYLQEHAHQLLEDHAVTELQKVELV"
FT   misc_feature    336792..337535
FT                   /gene="mecA"
FT                   /locus_tag="SUB0340"
FT                   /note="HMMPfam hit to PF05389, Negative regulator of
FT                   genetic competence (Me, score 3.1e-115"
FT                   /inference="protein motif:HMMPfam:PF05389"
FT   CDS             337557..338714
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="SUB0341"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40925"
FT                   /db_xref="GOA:B9DTL1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL1"
FT                   /protein_id="CAR40925.1"
FT                   /translation="MFPFTFDYVLVLIGAFLISLIATPFVRFLAFRVGAVDNPNARRIN
FT                   KVPMPSSGGLAIFIAFFMTTLVFMPFVNPQVFMNGHSYLSYILPVVLGALMIVTTGFID
FT                   DIYEISPKLKMLGIFFGAFIIWAFTSFRFDSFKIPFGGPLLHFGPIVTFFLTILWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQTDFFLTVTILILIASIAGFFPYNY
FT                   HPAIIYLGDTGALFIGFMIGVLSLQGLKNATAVVVVTPVIILGVPIMDTAVAIIRRSLS
FT                   GKKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGIALLFSLTSLLLNVSSRVGGLLLMLGF
FT                   LFGLEVLIEGLEIWGEKRTPLFNILKFIGNSDFRRSQSEKWKKKK"
FT   sig_peptide     337557..337661
FT                   /gene="rgpG"
FT                   /locus_tag="SUB0341"
FT                   /note="Signal peptide predicted for SUB0341 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.957) with cleavage site
FT                   probability 0.952 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(337566..337634,337695..337763,337806..337865,
FT                   337902..337955,337998..338066,338079..338147,
FT                   338157..338210,338229..338288,338316..338384,
FT                   338472..338540,338553..338621)
FT                   /note="11 probable transmembrane helices predicted for
FT                   SUB0341 by TMHMM2.0 at aa 4-26, 47-69, 84-103, 116-133,
FT                   148-170, 175-197, 201-218, 225-244, 254-276, 306-328 and
FT                   333-355"
FT   misc_feature    337815..338318
FT                   /gene="rgpG"
FT                   /locus_tag="SUB0341"
FT                   /note="HMMPfam hit to PF00953, Glycosyl transferase, score
FT                   9.3e-38"
FT                   /inference="protein motif:HMMPfam:PF00953"
FT   CDS             338997..339353
FT                   /transl_table=11
FT                   /locus_tag="SUB0342"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40926"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL2"
FT                   /protein_id="CAR40926.1"
FT                   /translation="MTSLFKKLFVTGLLACSLLASSNTVAFASHKTTTANGVELITKAQ
FT                   RTVETDGEIDTAIFGGFNNTFTGSEDTNPYNIEVDPFLYEIYEMYQLVGLAAKESGKYT
FT                   DQYPLHILFPNKNK"
FT   sig_peptide     338997..339080
FT                   /locus_tag="SUB0342"
FT                   /note="Signal peptide predicted for SUB0342 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             339551..340321
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="SUB0343"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40928"
FT                   /db_xref="GOA:B9DTL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL3"
FT                   /protein_id="CAR40928.1"
FT                   /translation="MSVLEIKNLHVSIEEKEILKGVNLTLKTGEIAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTEGEILLDGVNILDLEVDERARMGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKEDDDKISVRDFITKLDQKMELLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNDMRQKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAQLAQRLEKEGYSGIAEELGIDYKEEV"
FT   misc_feature    339635..340216
FT                   /gene="sufC"
FT                   /locus_tag="SUB0343"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-31"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    339656..339679
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    339986..340030
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             340427..341698
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="SUB0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="In S. thermophilus sufD mutant displayed increased
FT                   sensitivity to superoxide radicals compared to the wild
FT                   type. SufD is likely to play a major role in oxidative
FT                   stress defense, possibly resulting from its role in [Fe-S]
FT                   cluster assembly and/or repair"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40929"
FT                   /db_xref="GOA:B9DTL4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL4"
FT                   /protein_id="CAR40929.1"
FT                   /translation="MTFDNILRFSQAKAEPDWLVQRRQDAFKKIDELELPRIERVKFHR
FT                   WNLGDGSIQESPEVTAVPDFVAIGDNPTLLQVGTQTVLEQLPMDLIEKGVVFTDFYQAL
FT                   EEIPEIIREYFGSALAYDQDKLAAYHHAYFNSAAVLYVPDFVEISQPIEGIFLQDSDND
FT                   VAFNKHILIIAGKGSHFTYLERLESIGQGSAKASANISVEVIAKADSHIKFSAIDRLGE
FT                   TVTSFISRRGRLETNASIDWSLALMNEGNVVADFDSDLIGDGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGKNSVGHILQHGVILERGTLTFNGIGHIIKGAKGADAQQESRVLMLSDKA
FT                   RSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDKDTAERLVIRGFLGAVIAE
FT                   IPVKEVRENIISVLDQKLTARNKL"
FT   misc_feature    340901..341602
FT                   /gene="sufD"
FT                   /locus_tag="SUB0344"
FT                   /note="HMMPfam hit to PF01458, Uncharacterized protein
FT                   family (UPF0051), score 1.2e-54"
FT                   /inference="protein motif:HMMPfam:PF01458"
FT   CDS             341709..342935
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /gene_synonym="sufS"
FT                   /locus_tag="SUB0345"
FT                   /product="putative cysteine desulfurase"
FT                   /EC_number="4.4.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40930"
FT                   /db_xref="GOA:B9DTL5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL5"
FT                   /protein_id="CAR40930.1"
FT                   /translation="MINSQELKKDFPILDQLVHDEGYTYLDNAATTQKPKQVLDRIRRY
FT                   YDYDNANVHRGVHTLAERATRDYEASRQKVANFINANSSKEIVFTRGTTTSLNWVAQFA
FT                   KQILKPGDEVLISIMEHHANLIPWQEVCRQTGASLVYAYLKEGTLDLDDFKAKVTSKTR
FT                   FVCMAHVSNVLGCVNPIQEITAIAHGVGAYMVVDGAQSVPHMAVDVQALNCDFLAFSGH
FT                   KMLGPTGIGVLYGKEEVLKLMDPVEFGGEMIDFVYEQEASWKSLPWKLEAGTPNIAGAI
FT                   GLAAAIDYLESLGMSAIQNHERELVSYILPKLQAIDGLKLYGPGNPMDQTGVLSFNLDG
FT                   LHSHDVATALDYEGIAVRAGHHCAQPLLRHLGISAAVRASFYIYNTKEDCDRLVEAILK
FT                   TKEFFSGTL"
FT   misc_feature    341802..342887
FT                   /gene="csdB"
FT                   /gene_synonym="sufS"
FT                   /locus_tag="SUB0345"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 5.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   misc_feature    342348..342407
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00595"
FT   CDS             342922..343371
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="SUB0346"
FT                   /product="NifU-like protein"
FT                   /note="In S. thermophilus iscU mutant displayed increased
FT                   sensitivity to superoxide radicals compared to the wild
FT                   type. IscU is likely to play a major role in oxidative
FT                   stress defense, possibly resulting from its role in [Fe-S]
FT                   cluster assembly and/or repair"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40931"
FT                   /db_xref="GOA:B9DTL6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL6"
FT                   /protein_id="CAR40931.1"
FT                   /translation="MALSKLTSLYMAVVADHSKHPHHQGTLDGVEAVLLNNPTCGDVIS
FT                   LSVKFDGDVIEDIAFSGDGCTISTASASMMTDAVIGKTKAEALELARAFSDLVSGCQNP
FT                   KQKDLGEAELLEGVSKFPQRIKCSTLSWHALEKAIERSQEGSDEE"
FT   misc_feature    342946..343305
FT                   /gene="iscU"
FT                   /locus_tag="SUB0346"
FT                   /note="HMMPfam hit to PF01592, NifU-like N terminal domain,
FT                   score 2.3e-26"
FT                   /inference="protein motif:HMMPfam:PF01592"
FT   CDS             343392..344810
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="SUB0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40932"
FT                   /db_xref="GOA:B9DTL7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL7"
FT                   /protein_id="CAR40932.1"
FT                   /translation="MSDKNEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLNEAVVRELS
FT                   AAKGEPEWMLEFRLKSLETFQKMPMQTWGADLSDIDFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFERIGIPQAERAYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALKDATVEWVDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKGGGKVDYRGQVTFNKDSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   misc_feature    344022..344720
FT                   /gene="sufB"
FT                   /locus_tag="SUB0347"
FT                   /note="HMMPfam hit to PF01458, Uncharacterized protein
FT                   family (UPF0051), score 4.6e-119"
FT                   /inference="protein motif:HMMPfam:PF01458"
FT   CDS             345124..345405
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0348"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pyogenes surface protein SclB
FT                   UniProt:Q9ACN3_STRPY (EMBL:SPY301808) (399 aa) fasta
FT                   scores: E()=8.8, 37.143% id in 70 aa. CDS lacks an
FT                   N-terminal signal sequence, therefore the protein is not
FT                   likely to be processed"
FT                   /db_xref="PSEUDO:CAR40936.1"
FT   misc_feature    345277..345393
FT                   /locus_tag="SUB0348"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   5.8e-05"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS             complement(345516..346697)
FT                   /transl_table=11
FT                   /locus_tag="SUB0349"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40938"
FT                   /db_xref="GOA:B9DTL9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTL9"
FT                   /protein_id="CAR40938.1"
FT                   /translation="MIKKILLFLSIFALTISTIPVIANEKDSDDIMTITRKAGYSVKDI
FT                   NKPKSSIVIDAKNGDILWEDNINEHRDPASMSKLFTLYLLFEDLSKGKLSLETTITATD
FT                   RDQAISGIYEISNNKIISGVEYPIKDLIFMTAVPSSNAATVMIANYLSNNDASAFIDRI
FT                   NQKARELGMHDTFFSNASGAAAEAFKGLYNPDKYDLSAPNQTSAHDLAILTYHFLKEYP
FT                   EIVTYTNQRIVKTMVGTPYEEEFTTYNYSLPGDRYGMTGVDGLKTGSSPSGAFNAIVTT
FT                   KRNQKRLITIVMGVGDWSDQDGEYYRHPFINALTEKAFSDLKQKNNIPYSNLFHEKKQT
FT                   SSGRPSAKKSQHEQGQSFFHKFERFVDRNHSFIFIGLAIFIVLVLILSLLAIH"
FT   misc_feature    complement(order(345522..345590,346626..346685))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0349 by TMHMM2.0 at aa 5-24 and 370-392"
FT   misc_feature    complement(345807..346577)
FT                   /locus_tag="SUB0349"
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 1.6e-40"
FT                   /inference="protein motif:HMMPfam:PF00768"
FT   sig_peptide     complement(346629..346697)
FT                   /locus_tag="SUB0349"
FT                   /note="Signal peptide predicted for SUB0349 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(346790..347992)
FT                   /transl_table=11
FT                   /locus_tag="SUB0350"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40940"
FT                   /db_xref="GOA:B9DTM0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM0"
FT                   /protein_id="CAR40940.1"
FT                   /translation="MKKTILSTIIVGLFLWTPSTLVLAQEKLVINAKQAIAVECETGKI
FT                   LYQKEANQKAPIASLTKILTVYLTLKEIKNGKISWDTPVKMSDYAKELANNPDVSNPSL
FT                   YKDTFTVKELIDSSMVVSSNSAAISLAETIAGSEPQFVDMMKKQLQTWGIQDYQLVNAS
FT                   GLNNSMLNGHLYPKSKPNDENQLSAKNLAIVASHLISEFPEILAISSQSQLYWGNDVLQ
FT                   NSNHLLPGLSMGRLGVDGLKTGTTGCAGQTYIGTAVQDNMRVIVVILHANNAEQDSEAR
FT                   FVEANKLFDFAFQNFQSITIPKAKPYATKLAIIDGKKKKVAFISHKDFTIVQPKNDDSI
FT                   NYKVIQEKSKTKAPIEKDEKLGRIQFIDSSDYLKKKPSVAIFSFETVKKLSLFEKWFRF
FT                   N"
FT   misc_feature    complement(346826..347107)
FT                   /locus_tag="SUB0350"
FT                   /note="HMMPfam hit to PF07943, Penicillin-binding protein
FT                   5, C-termina, score 1.5e-06"
FT                   /inference="protein motif:HMMPfam:PF07943"
FT   misc_feature    complement(347174..347935)
FT                   /locus_tag="SUB0350"
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 3.8e-88"
FT                   /inference="protein motif:HMMPfam:PF00768"
FT   sig_peptide     complement(347921..347992)
FT                   /locus_tag="SUB0350"
FT                   /note="Signal peptide predicted for SUB0350 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.952 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(347921..347980)
FT                   /note="1 probable transmembrane helix predicted for SUB0350
FT                   by TMHMM2.0 at aa 5-24"
FT   CDS             complement(348061..349311)
FT                   /transl_table=11
FT                   /locus_tag="SUB0351"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40942"
FT                   /db_xref="GOA:B9DTM1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM1"
FT                   /protein_id="CAR40942.1"
FT                   /translation="MMKKMLLLCFIFLILFPINFVNADSTEDFHVKAKSAIAFDVSTGK
FT                   VLYQKNEKEVLPVASLSKVLTTYLVYKEVKSGKLSWDTPVTISNYPYELTTNYSISNVP
FT                   LDARQYTVKELLNAVLVTNANSAAIALAEKISGTEPRFVDLMTKQLKEWGIKDAKLVNA
FT                   TGLSNAILGDHIYPYSTSDDENQMSALDLAIVSNHLLSEFPEVLKHTQKASATFSNQKI
FT                   FSYNYMLKGMPNYRDGVNGLFVAYSEKSGASFLASSTENNMSVVTVVLNAEQSNEEELG
FT                   HFRETNTLLNYISNHFEPVILLEKGKKVPKTKLNLLDGKQKSVNLIAKKNLIGIRKIGS
FT                   QDGDSVTIDYKNKRTFAPVKRNEALARASFNDKEIIGTGYLDKTPTISLGAAKDVQKSF
FT                   FLKVWWNHFVNYVNTKL"
FT   misc_feature    complement(348121..348423)
FT                   /locus_tag="SUB0351"
FT                   /note="HMMPfam hit to PF07943, Penicillin-binding protein
FT                   5, C-termin, score 3.3e-08"
FT                   /inference="protein motif:HMMPfam:PF07943"
FT   misc_feature    complement(348439..349245)
FT                   /locus_tag="SUB0351"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   0.0001"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   misc_feature    complement(348490..349251)
FT                   /locus_tag="SUB0351"
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 2.1e-103"
FT                   /inference="protein motif:HMMPfam:PF00768"
FT   sig_peptide     complement(349243..349311)
FT                   /locus_tag="SUB0351"
FT                   /note="Signal peptide predicted for SUB0351 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   rRNA            349694..351237
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            351309..351381
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:351342..351344,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            351576..354474
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            354677..354799
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            354800..354873
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:354834..354836,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 74.15"
FT   tRNA            354943..355016
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:354977..354979,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 69.55"
FT   CDS             355107..355595
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="SUB0352"
FT                   /product="putative competence-specific global transcription
FT                   modulator"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40944"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM2"
FT                   /protein_id="CAR40944.1"
FT                   /translation="MFNHDFENCFEQVLPIILKLKRSFYIQLWDRDDWLQEGRIILHHL
FT                   MEDNPDLADNRMKLLCYFKTKFTSHIKDTLRYQESAKRRFNRLPYDEIGDVSHKIAEDG
FT                   LKLDDIVAFHTILNHLTPKLSENEMNQIQALFSNKRFSGRKKLLRKLKPFFVDFQDNL"
FT   CDS             355829..356356
FT                   /transl_table=11
FT                   /locus_tag="SUB0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40946"
FT                   /db_xref="GOA:B9DTM3"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM3"
FT                   /protein_id="CAR40946.1"
FT                   /translation="MSIDDYRPTFMVEAVYDLRADDLLRHGITAVFVDLDNTLIAWNNP
FT                   DGTPEVRAWLDEMTIADISVVVVSNNNYKRVERAVSRFGVDFISRAMKPFARGINIAIE
FT                   RYGFNRSEVIMVGDQLMTDIRASHRAGIKSVLVKPLVKSDAWNTKINRFREKRVFSKLE
FT                   KKYGKLTYQKGI"
FT   CDS             356356..357474
FT                   /transl_table=11
FT                   /locus_tag="SUB0354"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40947"
FT                   /db_xref="GOA:B9DTM4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM4"
FT                   /protein_id="CAR40947.1"
FT                   /translation="MEELFCIGCGIRIQTEDKNLAGFTPKAALEKGLESGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLKLLHEVGDSDALVVNVVDIFDFNGSIIPGLSRFVAGNDVLL
FT                   VGNKKDILPKSVKDSKVTQWLIERAYEEGLRPVDVFLTSAQNKYAIKELISRIDQLRKG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDIITTSRFPGTTLDKIEIPLDDGSFIFDTPG
FT                   IIHRHQMAHYLSDKDLKYVSPKKEIKPKTYQLNPEQTLFLGGLGRFDFVSGEKQGFTAY
FT                   FDNNLKIHRTKLEGASDFYQKHLGSLLLPPNHIDKESFPKLSSFDFTINSKMDLVFSGL
FT                   GWIRINGSEDKPVKITAWAPEGVAVLTRKAII"
FT   misc_feature    356845..357114
FT                   /locus_tag="SUB0354"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 2.3e-11"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    356863..356886
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             357529..357837
FT                   /transl_table=11
FT                   /locus_tag="SUB0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40949"
FT                   /db_xref="GOA:B9DTM5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM5"
FT                   /protein_id="CAR40949.1"
FT                   /translation="MLTSKQRAFLKSEAHHLKPIVQIGKNGLNNQIKTSVRNALDAREL
FT                   IKITLLQNTDEDINDVADILEEEIGCDTVLKIGRILILYKVSAKKENRKLSQKVKEL"
FT   misc_feature    357532..357783
FT                   /locus_tag="SUB0355"
FT                   /note="HMMPfam hit to PF01985, CRS1 / YhbY domain, score
FT                   4e-33"
FT                   /inference="protein motif:HMMPfam:PF01985"
FT   CDS             357901..358533
FT                   /transl_table=11
FT                   /locus_tag="SUB0356"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40951"
FT                   /db_xref="GOA:B9DTM6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM6"
FT                   /protein_id="CAR40951.1"
FT                   /translation="MAIELLTPFTKVELEGKEKDKNRKQIGILGGNFNPIHNAHLIVAD
FT                   QVRQQLGLDKVFLMPEYLPPHVDTKSTIDEKHRLEMVKLAIDSAEGLDVETLELERKGV
FT                   SYTYDTMKLLIEKNPDVDYYFIIGADMVDYLPKWHKIDELVKMVQFVGVQRPKYKAGTS
FT                   YPLIWVDVPLMDISSSMIRQFIKSKRQPNYLLPKAVLEYINKEGLYK"
FT   misc_feature    357982..358452
FT                   /locus_tag="SUB0356"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   2.5e-60"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS             358530..359123
FT                   /transl_table=11
FT                   /locus_tag="SUB0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40952"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM7"
FT                   /protein_id="CAR40952.1"
FT                   /translation="MSYQDYVPYTREELLEKIAAQMSKKRFKHVLGVEKAAIALAEKNQ
FT                   CNTDKAGLAGLLHDYAKECSDDVFKDYIKKYNLDSELLDWNNNVWHGMVGIYKIQEDFQ
FT                   LKDPDIQRAIEIHTVGSKTMSLLDKILYVADYIEEGRDFPLVDQARRIADDNLDKAVAF
FT                   ETVNTVAYLASKGQPIYPQTIETYNAFCHFLKEE"
FT   misc_feature    358605..358949
FT                   /locus_tag="SUB0357"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 2.6e-15"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS             359133..359486
FT                   /transl_table=11
FT                   /locus_tag="SUB0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40954"
FT                   /db_xref="GOA:B9DTM8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="InterPro:IPR025656"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM8"
FT                   /protein_id="CAR40954.1"
FT                   /translation="MKKEELLEIVVKAADEKRAEDTLALNLEGITSLTDYFVITSATNS
FT                   RQLEAIADNIREKVKEQGGNASHIEGDSASGWVLLDLNDVVVHIFSEEQRYHYNLEKLW
FT                   HDAPVVDIAPLLA"
FT   misc_feature    359142..359447
FT                   /locus_tag="SUB0358"
FT                   /note="HMMPfam hit to PF02410, Domain of unknown function
FT                   DUF143, score 6.1e-44"
FT                   /inference="protein motif:HMMPfam:PF02410"
FT   CDS             359537..360277
FT                   /transl_table=11
FT                   /locus_tag="SUB0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40956"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTM9"
FT                   /protein_id="CAR40956.1"
FT                   /translation="MTTYETFASVYDAIMDDSLYDKWTDFSLRHLPKTNEKKNLLELAC
FT                   GTGIQSLRFSQAGFNVTGLDLSHDMLAIARKRAEAGHQKIHFIEGNMLDLSEVGQYDFV
FT                   TCYSDSICYMQDEVEVGDVFKEVYNCLNPDGIFIFDVHSTYQTDEVFPGYSYHENAEDF
FT                   AMVWDSYEDDAPHSVVHELTFFIKDNDGRFTRHDEVHEERTYDILTYDILLEQAGFKSF
FT                   QIFADFEDKEPSEKSQRWFFVAQK"
FT   CDS             360298..361398
FT                   /transl_table=11
FT                   /locus_tag="SUB0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40957"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTN0"
FT                   /protein_id="CAR40957.1"
FT                   /translation="MAVTGIVAEFNPFHYGHKYLLEQAEGLKIVAMSGNFVQRGEPAIV
FT                   DKWTRAQMALENGADIVVELPFQVAVQSADYFAQGAVDILSTMGADTLAFGTEEDLDYS
FT                   EIARIYEEKAEQMTAFLETLDDSLSYPQKTQKMWESFTGIDFSGNTPNHILALAYAKAS
FT                   AGKNLRLQPIKRQGAAYHSQEKNQMMASATAIRKHISDRTFVLQSTPSSELLLMAPQVN
FT                   WENYFDLVRYHILSQEQLDHVFQVNQEIANRLKSAIVHVHSIEELVDKVSTKRYTKARV
FT                   RRILTYILVNARENNLPNGVHVLGFTEKGQEHLKKMKKSISIVSRIGAVPWDQQTQTAD
FT                   RIYQLGHSDIKEQNFGRSPIRIEKLG"
FT   misc_feature    360298..361377
FT                   /locus_tag="SUB0360"
FT                   /note="HMMPfam hit to PF05636, Protein of unknown function
FT                   (DUF795), score 7.7e-202"
FT                   /inference="protein motif:HMMPfam:PF05636"
FT   CDS             join(361487..361531,361533..361583,361587..362207)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0361"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Streptomyces lividans HTH-type
FT                   transcriptional activator TipA UniProt:TIPA_STRCO
FT                   (EMBL:SCO939116) (253 aa) fasta scores: E()=1.4e-17,
FT                   34.146% id in 246 aa. CDS contains a frameshift after codon
FT                   15. CDS contains a nonsense mutation (amber) after codon
FT                   32"
FT                   /db_xref="PSEUDO:CAR40959.1"
FT   misc_feature    361818..362198
FT                   /locus_tag="SUB0361"
FT                   /note="HMMPfam hit to PF07739, TipAS antibiotic-recognition
FT                   domain, score 4.9e-49"
FT                   /inference="protein motif:HMMPfam:PF07739"
FT   CDS             362251..362613
FT                   /transl_table=11
FT                   /locus_tag="SUB0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40960"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN2"
FT                   /protein_id="CAR40960.1"
FT                   /translation="MTELSPLQWTFISECQIPDDVRDILVSGEEPIAAYKTIRDTAIFT
FT                   SKRLIVKDAQGLTGKKVETYSLPYKSINMWSTENAGTFDFNSEVELWTRAGHIKIQLKR
FT                   GIDIRRFDRVIASVLL"
FT   CDS             362674..363510
FT                   /transl_table=11
FT                   /locus_tag="SUB0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40962"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN3"
FT                   /protein_id="CAR40962.1"
FT                   /translation="MTKIAITGVTGKLGGFLAEELAQKGLEARHLARSPEKAKQYPKAE
FT                   IRQSFYDESELTIASLNGVDVLFMVSARESQTRLDEHKAFLRSAQKAGIKHIIYTSFMD
FT                   AKPNSTFTLARDHAWTEAYIKELGFTYTFLRDNFYQDMFLEIAEQSSLLRGPAGQGKVS
FT                   AVLRSDVAAVALRILREPAKWENQTLNLTGPQALSLEEMATLLSQYLGKEVTYYNEGIE
FT                   EAYEWRKQWPVEDWQYDAWVSTYTAIAKDELSIVSNDIEKVLGRPATSLEDFLKNR"
FT   CDS             363645..364361
FT                   /transl_table=11
FT                   /locus_tag="SUB0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40965"
FT                   /db_xref="GOA:B9DTN4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTN4"
FT                   /protein_id="CAR40965.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGDPDPESNS
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYMFDKKGVIVFEGDDADTVFEQLLEADVEVDDVEA
FT                   EDGAITVYTAPTDLHKGIQALRDNGIETFKVTELEMIPQSEVTLEGDDLATFEKLVDAL
FT                   EADDDVQKVYHNVADF"
FT   misc_feature    363651..364352
FT                   /locus_tag="SUB0364"
FT                   /note="HMMPfam hit to PF01709, Domain of unknown function
FT                   DUF28, score 8.3e-128"
FT                   /inference="protein motif:HMMPfam:PF01709"
FT   CDS             364497..365321
FT                   /transl_table=11
FT                   /locus_tag="SUB0365"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40966"
FT                   /db_xref="GOA:B9DTN5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN5"
FT                   /protein_id="CAR40966.1"
FT                   /translation="MMTLKKNLGILSLTLGTLAILAACGNKASNNSGKEEVFFATVGTT
FT                   APFSYEKDGKLTGYDIEVAKAVFKDSSKYKVSFKKTEWSSMFTGLDSSKYQMAGNNVSF
FT                   TKERASKYLFSYPTGTTPSVLVVPKDSNIKTYDDIKNHSTQVVQGTTTAAQLEDYNKSN
FT                   PDHQVTLKYTNENITQILANLNDGKADFKIFDAPTVNTIIKNQGLDHLKTIPLESKEQP
FT                   YIYFIFGQDQKDLQKFVNKRLKELQKDGTLRQLAKEYLGGEFEPQADQLKLP"
FT   sig_peptide     364497..364571
FT                   /locus_tag="SUB0365"
FT                   /note="Signal peptide predicted for SUB0365 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.604 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    364536..364568
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    364605..365282
FT                   /locus_tag="SUB0365"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 7.3e-70"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   CDS             365488..366333
FT                   /transl_table=11
FT                   /locus_tag="SUB0366"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40968"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN6"
FT                   /protein_id="CAR40968.1"
FT                   /translation="MSYKKILGLIGLTLVSSVLVACGSDQNDNKTLTVGVMTKTSSDDA
FT                   RWKKIESLLKKDGIKLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKENLV
FT                   SIADTYISPIHLFSGTTQKGKAKYTSVEDLPKGAQIAIPNDATNESRALYVLQSAGLIK
FT                   LNVSGDKLATIANVTENKKDLDIKELDASQTARSLTSADAAIVNNSYAVPAKIDYKTSL
FT                   YKENVDQNSKQWVNILAGKKDWEKSDKAAAIKKLVKAYHTDELKKVVEDTSEGIDVPVW
FT                   "
FT   sig_peptide     365488..365556
FT                   /locus_tag="SUB0366"
FT                   /note="Signal peptide predicted for SUB0366 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983) with cleavage site
FT                   probability 0.779 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    365521..365553
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    365581..366330
FT                   /locus_tag="SUB0366"
FT                   /note="HMMPfam hit to PF03180, NLPA lipoprotein, score
FT                   1.6e-116"
FT                   /inference="protein motif:HMMPfam:PF03180"
FT   CDS             366438..367811
FT                   /transl_table=11
FT                   /locus_tag="SUB0367"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40969"
FT                   /db_xref="GOA:B9DTN7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN7"
FT                   /protein_id="CAR40969.1"
FT                   /translation="MNQKTSQLSQKIFESNPVITFYIDKLNELLSIKSIFAQDVGLEEA
FT                   ANFLSSLFKEAGAEVTLDKSFKAPFLIARFKSSSPNAKTLLFYNHYDTVPADSDQKWHF
FT                   EPFTLSIKENKMYGRGVDDDKGHIIARLTAVINYLNNHKDLPINVTFIMEGAEESASVD
FT                   LESYLLAHQEELSKADLLIWEQGIKNEKNQLELTGGNKGILTFDMAVKSADSDIHSKYG
FT                   GVVDSATWYLLRAISSLRDDQGHLLVDGIYDKIKPANQRELALVEQFAVENPEIVKKLY
FT                   GLSLPMLQSDRRAFLRRYYFEPSVTIQGISSGYLGSGVKTIIPSYASAKMEIRLVPGLD
FT                   PKEVFEAVSNHLRVHGFGLVELNYTLGEKSYRSDLSSPEVQALIDLVSQNHPGGVCLLP
FT                   TSAGTGPMHTVYSVLKVPMVSLGMGNPNSSDHSGDENVLISDYLEHITLIEELIKSYE"
FT   misc_feature    366693..367802
FT                   /locus_tag="SUB0367"
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 3.9e-23"
FT                   /inference="protein motif:HMMPfam:PF01546"
FT   misc_feature    367029..367517
FT                   /locus_tag="SUB0367"
FT                   /note="HMMPfam hit to PF07687, Peptidase dimerisation
FT                   domain, score 7.7e-17"
FT                   /inference="protein motif:HMMPfam:PF07687"
FT   CDS             367804..368868
FT                   /transl_table=11
FT                   /locus_tag="SUB0368"
FT                   /product="putative D-methionine transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40971"
FT                   /db_xref="GOA:B9DTN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN8"
FT                   /protein_id="CAR40971.1"
FT                   /translation="MSETMIQLDHIDITFHQRKRQIEAVKDVSIAINKGDIYGIVGYSG
FT                   AGKSTLVRVINLLQIPTAGTITVDGDRTFMDGKVQLSTQELRQKRRDIGMIFQHFNLMA
FT                   QKTARENIAFALRHSKLSKDDINQKVNELLDLVGLSDRADNYPAQLSGGQKQRVAIARA
FT                   LANNPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGSLIEEGSVLDIFSNPQRPLTKEFITTATGIDEALEKINQQEIVQHLPKDALLVQL
FT                   KYAGTSTDEPILNQIYRQYEVTANILYGNIEILDGVPVGEMVVVLEGQSQNIKAAEKAL
FT                   VAAGVSITILKRGA"
FT   misc_feature    367906..368481
FT                   /locus_tag="SUB0368"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-69"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    367927..367950
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    368251..368295
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             368869..369561
FT                   /transl_table=11
FT                   /locus_tag="SUB0369"
FT                   /product="putative D-methionine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40972"
FT                   /db_xref="GOA:B9DTN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTN9"
FT                   /protein_id="CAR40972.1"
FT                   /translation="MSELLQTYLPNVYQLGWTGDAGWGLAIWNTLYMTVVPFIVGGAIG
FT                   LFLGLMLVLMGPNGVIENKAVCWVLDKFTSIFRAIPFVILIAILASFTYMIMGTTLGAT
FT                   AALVPLTFATFPFFARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLGEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATLIILLIIFAIQFFGDW
FT                   LTKKFSHK"
FT   misc_feature    368947..369555
FT                   /locus_tag="SUB0369"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7e-16"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    order(368962..369030,369091..369159,369169..369225,
FT                   369373..369441,369469..369537)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0369 by TMHMM2.0 at aa 32-54, 75-97, 101-119, 169-191
FT                   and 201-223"
FT   CDS             complement(369583..370953)
FT                   /transl_table=11
FT                   /locus_tag="SUB0370"
FT                   /product="putative branched-chain amino acid transport
FT                   system carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40973"
FT                   /db_xref="GOA:B9DTP0"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP0"
FT                   /protein_id="CAR40973.1"
FT                   /translation="MKQHKIYIMIGFMLFALFFGAANLIYPAFLGLYSGKNLIWSILGF
FT                   CLTGVSLPLLGVIAISKSGSEDVKSLSAPISKWFAIVYSSLLYLSIGPFFAIPRTGATS
FT                   FSVGIAPIFGDNIIIKCLYAMLFFGLSYYLAIRPSRLAENIGKFLTPTLLIVIAILIIS
FT                   SFLHPAGSYGTSINVDSGINNAFKDFPFMAGLIQGYGTMDALASLVFSIIVIDAVKQFG
FT                   ATSDREVTQMTLISGLIAIGLLAFVYIFIGRIGATSQNLFSFSDGHFTLHHRPVNGGQI
FT                   LSHAAHFYLGRLGQTCLAIIIFLACLTTSTGLISSSAEFFHKLLPKVSYFVWASLFTLV
FT                   STFFYFGGLNEIIKWSAPVLYLLYPLTIVIIFLVLCKDFFGNDALVYRITVLFTTIPAL
FT                   YDALSTLSKMTGLFQVPTLLSQFFEKTVPLGQFALGWIPFAIIGTVMSLLIKKIKKS"
FT   misc_feature    complement(369592..370947)
FT                   /locus_tag="SUB0370"
FT                   /note="HMMPfam hit to PF05525, Branched-chain amino acid
FT                   transport p, score 1.7e-201"
FT                   /inference="protein motif:HMMPfam:PF05525"
FT   misc_feature    complement(order(369607..369675,369733..369801,
FT                   369826..369885,369913..369972,369991..370059,
FT                   370186..370254,370315..370383,370426..370494,
FT                   370552..370620,370663..370722,370771..370839,
FT                   370867..370935))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0370 by TMHMM2.0 at aa 7-29, 39-61, 78-97, 112-134,
FT                   154-176, 191-213, 234-256, 299-321, 328-347, 357-376,
FT                   385-407 and 427-449"
FT   CDS             complement(371162..371833)
FT                   /transl_table=11
FT                   /locus_tag="SUB0371"
FT                   /product="TrkA family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40975"
FT                   /db_xref="GOA:B9DTP1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP1"
FT                   /protein_id="CAR40975.1"
FT                   /translation="MKRKTIAVLGLGIFGRTVAKQLSQFDQDVIAIDTNEHYVDEIGDF
FT                   VTKAAVGDMTDKDFLLAIGIDQCDIVVIATGNNLESSVLAIMHCKKLKVPVIIAKAKNK
FT                   TFEEVLYGIGATKVITPERDSGKRVASNILKRHIESIIYLEHGISLINFEIPKSWVGKS
FT                   LTELDIRQKYELNIIGTRLEKDGNLNPNVNPIEPLKEHTILAAIANDHTFEKFDYLGYL
FT                   K"
FT   misc_feature    complement(371471..371821)
FT                   /locus_tag="SUB0371"
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   5.2e-35"
FT                   /inference="protein motif:HMMPfam:PF02254"
FT   sig_peptide     complement(371741..371833)
FT                   /locus_tag="SUB0371"
FT                   /note="Signal peptide predicted for SUB0371 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.771) with cleavage site
FT                   probability 0.750 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(371844..373220)
FT                   /transl_table=11
FT                   /locus_tag="SUB0372"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40977"
FT                   /db_xref="GOA:B9DTP2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP2"
FT                   /protein_id="CAR40977.1"
FT                   /translation="MFFSWIRTWSITRRLTFSFALVILIGSILLSLPFFQYQNASESVY
FT                   LDHLFNVVSMVCVTGLSVIPISEVYNGFGQMVAIILMQIGGLGLVTLIAFSTFALQKKM
FT                   DLSGHSLLQSALNRNDSTNLKHYLFFAYKVTFAIESIAFLVILTDFIPRFGLKNGIFNS
FT                   LFLAVSAFCNAGFDNFGSNSLTDFVVNPTINFVVALLIIFGGIGFAVWYDLSNNLKRYF
FT                   YDKPKCHGLFYQKLSNQTRLILQTTLIILITGTLITWFLEKDNPNTIANYNLWQQLMVS
FT                   FFQTVTMRTAGFATLSYTDTLAPTNFLYMIQMIIGGAPGGTAGGVKVTTVAIVFLLLKS
FT                   ELKAQSQVTFHHRMIASKTVKQTMSVLIFFFTILTIGYILLLAVEPYIDPVALLFEAIS
FT                   AIDTVGVTMNVTPKLSTPGRIIIMLLMFIGRVGPITFLLSLIARKEKTIRYATTDILVG
FT                   "
FT   misc_feature    complement(371886..372878)
FT                   /locus_tag="SUB0372"
FT                   /note="HMMPfam hit to PF02386, Cation transport protein,
FT                   score 9e-58"
FT                   /inference="protein motif:HMMPfam:PF02386"
FT   misc_feature    complement(order(371895..371963,372057..372125,
FT                   372207..372275,372333..372401,372438..372497,
FT                   372576..372644,372681..372749,372777..372845,
FT                   372927..372995,373023..373091,373110..373178))
FT                   /note="11 probable transmembrane helices predicted for
FT                   SUB0372 by TMHMM2.0 at aa 15-37, 44-66, 76-98, 126-148,
FT                   158-180, 193-215, 242-261, 274-296, 316-338, 366-388 and
FT                   420-442"
FT   misc_feature    complement(372387..372416)
FT                   /note="PS00904 Protein prenyltransferases alpha subunit
FT                   repeat signature."
FT                   /inference="protein motif:Prosite:PS00904"
FT   sig_peptide     complement(373092..373220)
FT                   /locus_tag="SUB0372"
FT                   /note="Signal peptide predicted for SUB0372 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.914) with cleavage site
FT                   probability 0.909 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(373307..374020)
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SUB0373"
FT                   /product="methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40979"
FT                   /db_xref="GOA:B9DTP3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTP3"
FT                   /protein_id="CAR40979.1"
FT                   /translation="MTPEVFYKALEDFDIHLNDFQKEQFDIYFQTLVEWNDKINLTAIT
FT                   EKNDVYLKHFYDSIAPILHGYIKNEPIKLLDIGAGAGFPSIPMKIIYPQLDITIIDSLN
FT                   KRITFLKQLSEVLHLEGVHFFHGRAEDFGQDINFRAQFDIVTARAVARMQILSELTIPF
FT                   LKLNGKLLALKAQAVDQELTDAQNALKLLFSQVIENNHYQLPNGDSRYITIVEKKKETP
FT                   RKYPRKAGTPNKKPL"
FT   misc_feature    complement(373382..373960)
FT                   /gene="gidB"
FT                   /locus_tag="SUB0373"
FT                   /note="HMMPfam hit to PF02527, Glucose inhibited division
FT                   protein, score 1.2e-54"
FT                   /inference="protein motif:HMMPfam:PF02527"
FT   CDS             374167..374724
FT                   /transl_table=11
FT                   /locus_tag="SUB0375"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40981"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP4"
FT                   /protein_id="CAR40981.1"
FT                   /translation="MPMFLIILIVLGLLAVWVMINYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYAAYEEKTFEKIAELRSQVTHAATPVATMEASNELTKQVASLIAV
FT                   AENYPELKANTNFLKLQDELTNTENKISYSRQLFNTTTSQYNMKLETFPSNIVATIFGF
FT                   KPSEFLQTPEEEKAVPKVDFNV"
FT   misc_feature    374176..374244
FT                   /note="1 probable transmembrane helix predicted for SUB0375
FT                   by TMHMM2.0 at aa 4-26"
FT   misc_feature    374254..374715
FT                   /locus_tag="SUB0375"
FT                   /note="HMMPfam hit to PF04011, LemA family, score 3.2e-76"
FT                   /inference="protein motif:HMMPfam:PF04011"
FT   CDS             374759..375652
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SUB0376"
FT                   /product="probable protease HtpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40982"
FT                   /db_xref="GOA:B9DTP5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTP5"
FT                   /protein_id="CAR40982.1"
FT                   /translation="MLYQQIAQNKRKTIFLILAFFFLLTAIGAAAGYLLVESYQFGIVL
FT                   ALILGSIYAFSMIFQSTNVVMGMNKAREITVDQAPDFFHIVEDMAMVAQIPMPKVYIID
FT                   DPSLNAFATGSSPENAAVAATSGLLQVMNREELEGVIGHEISHIRNYDIRISTIAVALA
FT                   SAITLIASMGSRMMWYGGGRQRQNDRDNSSLGIVFLIFSLLSLILAPLIASMVQLAISR
FT                   QREYLADASSVELTRNPEGMIRALEKLSQSQPMSHPVDDASSALYINEPQKRESLSSLF
FT                   STHPPIADRIERLRHM"
FT   sig_peptide     374759..374845
FT                   /gene="htpX"
FT                   /locus_tag="SUB0376"
FT                   /note="Signal peptide predicted for SUB0376 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.509 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(374795..374863,374876..374935,375227..375295,
FT                   375338..375406)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0376 by TMHMM2.0 at aa 13-35, 40-59, 157-179 and
FT                   194-216"
FT   misc_feature    375011..375649
FT                   /gene="htpX"
FT                   /locus_tag="SUB0376"
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   4.6e-21"
FT                   /inference="protein motif:HMMPfam:PF01435"
FT   CDS             375865..376398
FT                   /transl_table=11
FT                   /locus_tag="SUB0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40992"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP6"
FT                   /protein_id="CAR40992.1"
FT                   /translation="MIFISDLKKKQEPVHFKESLDIKDKLLERNKDILDIKDVLAIGTV
FT                   SYEEGIFLLNYHLSYTLTMPSSRSMKAVTLYQENDINELFIEESQVTQNKDIVEEELVL
FT                   ILSGETIDIEESVIDNILLDIPLQVLAPEEENSVDMPKGKEWTVLTEEQYQSMKADTAK
FT                   ENNPFASLNGLFDE"
FT   misc_feature    375883..376392
FT                   /locus_tag="SUB0377"
FT                   /note="HMMPfam hit to PF02620, Uncharacterized ACR,
FT                   COG1399, score 3.1e-42"
FT                   /inference="protein motif:HMMPfam:PF02620"
FT   CDS             376508..376624
FT                   /transl_table=11
FT                   /locus_tag="SUB0378"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40994"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP7"
FT                   /protein_id="CAR40994.1"
FT                   /translation="MDRHLCPELTDDKTVYGQKISVNLSYIKIKIEGNKEKI"
FT   CDS             376621..377307
FT                   /transl_table=11
FT                   /gene="csrR"
FT                   /locus_tag="SUB0379"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40995"
FT                   /db_xref="GOA:B9DTP8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP8"
FT                   /protein_id="CAR40995.1"
FT                   /translation="MTKKILIVEDEKNLARFVSLELQHEGYEVTVEVNGREGLETALEK
FT                   DFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIETEKKAPNQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   NILMSNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDMPGRESYIQTVRGMG
FT                   YVIREK"
FT   misc_feature    376627..376983
FT                   /gene="csrR"
FT                   /locus_tag="SUB0379"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.6e-38"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    376885..376962
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:Prosite:PS00217"
FT   misc_feature    377068..377295
FT                   /gene="csrR"
FT                   /locus_tag="SUB0379"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 3.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   CDS             377311..378813
FT                   /transl_table=11
FT                   /gene="csrS"
FT                   /locus_tag="SUB0380"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40997"
FT                   /db_xref="GOA:B9DTP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTP9"
FT                   /protein_id="CAR40997.1"
FT                   /translation="MKKEIQKKQKYKRSLPKRLSNLFFVLFFCIFSAFTLIAYYSTDYF
FT                   LVKKEKQSLTQTVNLVRVRLSEVDSNFSFDNLAEVLYKNDKSNLKIDSSGDSDIIRSHR
FT                   DITNILDAKQEIYIYNVEKRMIFTTDDEEFSYQLEGPLNKVFTDAVENQYRGFSIIKKV
FT                   YSKKTQKVIGYVQIYQDLEDYYVIRARLLLWLIFVELFGTCLAYLIIYFSTRKFLEPIK
FT                   NLHEVMRNISENPNNLALRAHIQSGDEIEELSIIFDNMLDKVENYTTLQSRFISDVSHE
FT                   LRTPVAIIKGHIGLLQRWGKDDHDILEESLSATAHEADRMAIMINDMLDMIRVQGSFEG
FT                   HQHDTTQLESSIETVIGNFRVLKEDFTFNWTPRDSKTLARIYKNHFEQALMILIDNAIK
FT                   YSRNEKVISVDLDCDDQYAILKVSDRGEGISEEDIKHIFERFYRTDKSRNRTSTQAGLG
FT                   IGLSILQQIVEGYHLSMKVESQLNQGSTFIIFIPLAQQKGIE"
FT   sig_peptide     377311..377424
FT                   /gene="csrS"
FT                   /locus_tag="SUB0380"
FT                   /note="Signal peptide predicted for SUB0380 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.962 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(377368..377436,377881..377949)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0380 by TMHMM2.0 at aa 20-42 and 191-213"
FT   misc_feature    377893..378108
FT                   /gene="csrS"
FT                   /locus_tag="SUB0380"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 1.9e-11"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    378118..378321
FT                   /gene="csrS"
FT                   /locus_tag="SUB0380"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.8e-17"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    378451..378792
FT                   /gene="csrS"
FT                   /locus_tag="SUB0380"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4e-32"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             378976..379470
FT                   /transl_table=11
FT                   /locus_tag="SUB0381"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR40999"
FT                   /db_xref="GOA:B9DTQ0"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTQ0"
FT                   /protein_id="CAR40999.1"
FT                   /translation="MRCPKCNYNKSSVVDSRQAEDGNTIRRRRECEKCHTRFTTFERLE
FT                   ELPLLVVKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENLISRIEQKVRANYENEVS
FT                   STAIGNLVMEELAELDEITYVRFASVYKSFKDVDEIEALLQQITNRVRGKKKSSIDDET
FT                   H"
FT   misc_feature    379066..379083
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    379120..379392
FT                   /locus_tag="SUB0381"
FT                   /note="HMMPfam hit to PF03477, ATP cone domain, score
FT                   4.5e-32"
FT                   /inference="protein motif:HMMPfam:PF03477"
FT   CDS             379454..380650
FT                   /transl_table=11
FT                   /locus_tag="SUB0382"
FT                   /product="replication initiation and membrane attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41001"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ1"
FT                   /protein_id="CAR41001.1"
FT                   /translation="MMKPIDTFYYIKHNQVQVNVGSLIQLYFPIIGGDAFALYHYFTQF
FT                   FDNGSRSHKLTEVLNHLQFGMPRLEEALSLLTALDLLSLYQFSEHYLIKINPPLDKDTF
FT                   LSNPVYKSLLEKEIGELAVSDMMMTVPYEAREMSKSFSEVFGSKITTSEAMSKAKAYVP
FT                   KIHFDLDSFKNLMIRDGLQFEDEKSDIVQLYSLMEQYKMTWFDLYQLAKETAINGKIAP
FT                   SRLLVKKQESQHISVDTAQFTAAEQIILKEAKNDTALIFLEKIKNARHARVTKDERELL
FT                   ISLAKMNFLDEVINVMVLYTFNKTKSANLQKNYLLKIANDFSYQRVTRAEDAILKMRTF
FT                   EERKLQSTASTKKVTKSNVPAWSNPDYKESTSPEQQAELDRFKEEALKRLENLSKGGE"
FT   misc_feature    379457..380641
FT                   /locus_tag="SUB0382"
FT                   /note="HMMPfam hit to PF07261, Replication initiation and
FT                   membrane attachme, score 1.7e-06"
FT                   /inference="protein motif:HMMPfam:PF07261"
FT   misc_feature    379511..379579
FT                   /note="1 probable transmembrane helix predicted for SUB0382
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS             380651..381553
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="SUB0383"
FT                   /product="putative primosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41002"
FT                   /db_xref="GOA:B9DTQ2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ2"
FT                   /protein_id="CAR41002.1"
FT                   /translation="MEKIGNTISKLHQANRGNSEQLIENILSDPEVADFISSHHLTQDE
FT                   IRLSLSKFNQFLVERQKYQTNDNAYIAKGYAPILVMNEGYADVSYLETKELIEAKRKAA
FT                   ISERINLVNLPKSYRHIKMSDFDINNASRMRAMSEILDFVENYPSAGQKGLYLYGDMGI
FT                   GKSYMMAAMARELSEKKGVSTTLLHFPTFTIDVKNAISSGSVKEEIDAVKSVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEELPTFFTSNYSLSDLERKWANIKGNDETWQAKRV
FT                   MERVRYLAREFHLEGVNRR"
FT   misc_feature    380651..380977
FT                   /gene="dnaI"
FT                   /locus_tag="SUB0383"
FT                   /note="HMMPfam hit to PF07319, Primosomal protein DnaI
FT                   N-terminus, score 3.1e-48"
FT                   /inference="protein motif:HMMPfam:PF07319"
FT   misc_feature    381125..381148
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             381602..382912
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="SUB0384"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41004"
FT                   /db_xref="GOA:B9DTQ3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTQ3"
FT                   /protein_id="CAR41004.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRKFSLIDTGGIDDVDAPFMEQIKHQAQIAMDEADVIVFVVSGKEGVTDADEYVA
FT                   KMLYRTNKPVILAVNKVDNPEMRNDIYDFYALGLGDPYPASSVHGIGTGDILDAIIEKL
FT                   PVEEEEINDNTIRFSLIGRPNVGKSSLINAILGEERVIASPVAGTTRDAIDTHFTDQDG
FT                   QEYNMIDTAGMRKSGKVYENTEKYSVMRAMRAIDRSDVVLLVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDLLEKDNHTVAKWEADIRDQFQFLSYAPIIFVSALTKQRLNKLP
FT                   ELIKKISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVSVKPPTFVIFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   misc_feature    381611..381967
FT                   /gene="engA"
FT                   /locus_tag="SUB0384"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1e-46"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    381629..381652
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    382124..382492
FT                   /gene="engA"
FT                   /locus_tag="SUB0384"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 2.8e-43"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    382142..382165
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             383062..386151
FT                   /transl_table=11
FT                   /locus_tag="SUB0385"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41006"
FT                   /db_xref="GOA:B9DTQ4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ4"
FT                   /protein_id="CAR41006.1"
FT                   /translation="MARLIPGRIRNQGIDLFDKGLVSINHEKKGLISAQVDSYQVSYGI
FT                   EDSMISCQCSFFETKKYCQHIAALEHFMKNSQEGKTLLTRLTDQNKEKDEVDKMTSFGS
FT                   LFLDSLKMNEDDTISYKLSAVGSRSPFSSDFWWSLKIKRLPDQRTYVIRDIRGFLSIVE
FT                   KEGYYQIGKNYYEPLSLIQFDIASQELIQFLWRLAPNFEKTENSLLFPNHARNLYLPCG
FT                   FFEEGIRLLTDLEDFSFEGPQKTYSHVWVRPLDNQFDLFCFHVEVHRKSIELQIKEKAM
FT                   QFLFDNEYILFQDTFYHLDLKQRKMVAAIRSLPIQADLTKHVHFDLDDQAKLAASLLDF
FT                   KELGTVTAPKSFDIRDFDVTFQFSLEDAKTIQLQLIFDFGTIQVRGKADLDQLPFASNY
FT                   KKEEKIYRSLKQFGFRGHFISRYEFHDAHDLFDFFMQTLPHFETLGKVTITEQLEALRF
FT                   TQSPQIIVDKMGSLLDISFDFSSVFESDIDQAMRALLSNKPYFVSEKGQLVIFDDNTQK
FT                   ISKSLQELRAKQGSNGHIQVDGIAALQVTQMFNGMENVQLTQEIAELVMDLTHPENFDL
FT                   PKLSVNATLRDYQIHGIKWMSTLDKYGFGGILADDMGLGKTLQTITFLATKMTSETKVL
FT                   ILTPSSLLYNWLDEFEKFLPQSDVAVAYGLKQYRDQVISENHQITITSYASFRQDFDRY
FT                   QDDTFDYLILDEAQVIKNAQTKIAQSLRHFNVKNCFALSGTPIENKLLEIWSIFQIVLP
FT                   GLLPSKKDFQKMKAKEVSKRVRPFVLRRKKEDVLPELPDLIEITYTNEMSDDQKAIYLA
FT                   QLRHMQDRIKNASDADINRQKIEILSGITRLRQICDTPSLFTEYDGDSGKLECLRTLLL
FT                   QVKENGHRALIFSQFKGMLEIAEKELEEMGLNSYKITGSTPANERQEMTRAFNNGSKDA
FT                   FLISLKAGGVGLNLTGADTVVLIDLWWNPAVEMQAISRAHRIGQDDNVEVYRLITRGTI
FT                   EEKILALQETKRNLVTTVLDGDESRAHLTVEDIKEILGIS"
FT   misc_feature    383176..383283
FT                   /locus_tag="SUB0385"
FT                   /note="HMMPfam hit to PF04434, SWIM zinc finger, score
FT                   2.4e-06"
FT                   /inference="protein motif:HMMPfam:PF04434"
FT   misc_feature    384814..385293
FT                   /locus_tag="SUB0385"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 9.4e-06"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    384823..385620
FT                   /locus_tag="SUB0385"
FT                   /note="HMMPfam hit to PF00176, SNF2 family N-terminal
FT                   domain, score 1.2e-62"
FT                   /inference="protein motif:HMMPfam:PF00176"
FT   misc_feature    385675..385701
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT                   /inference="protein motif:Prosite:PS00697"
FT   misc_feature    385747..385980
FT                   /locus_tag="SUB0385"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 7.5e-26"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS             complement(386216..387019)
FT                   /transl_table=11
FT                   /locus_tag="SUB0386"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41009"
FT                   /db_xref="GOA:B9DTQ5"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ5"
FT                   /protein_id="CAR41009.1"
FT                   /translation="MKNKCIFFTLVILSTYRIFQELLILLQLNLDKGGLQTLFTAIGIL
FT                   LISYILPLSFMSILFLYKKKISLIWFFMSLFFGIFVIGQISGWININVTNLLNQLFPHS
FT                   DFIKNWTPSISPPLFEEVLKFLLAIIIILLAKIHNIWHCLIIGLAVGLGFQISEDYTYL
FT                   IAAIVDKQSPITEAFSRVEFGLATHWLMTSLMIGSYFLKQQSKAQKWAINLFILCPIFL
FT                   HIAWNSPYTDHSILVKMVLFMFSWIIYITLLFKIHQANPIFSRVK"
FT   misc_feature    complement(order(386228..386296,386339..386392,
FT                   386558..386647,386756..386824,386837..386905,
FT                   386933..387001))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0386 by TMHMM2.0 at aa 7-29, 39-61, 66-88, 125-154,
FT                   210-227 and 242-264"
FT   CDS             complement(387031..387741)
FT                   /transl_table=11
FT                   /locus_tag="SUB0387"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41013"
FT                   /db_xref="GOA:B9DTQ6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ6"
FT                   /protein_id="CAR41013.1"
FT                   /translation="MQKLKYLQIVDVIILTIILFGQAIYSSTLSFLNTKGLGDSTLTYT
FT                   SSLQNFQMIIFQGILILIALTYLYFRRFDFRQWQCQFSLRSTAIALFLFLTLAIMMDLL
FT                   FFILDENFRNALFYYPWNFSEGVKQIILQFKNFPLILYAVLNGVYEELFFIGICNYVIP
FT                   KAKKLIFVLSLIIRISFHTYQGLLSAIGIGLFLGITYFWFYNNKSKNLYPIFLSHTIAD
FT                   ILGLSIVRYFIIAV"
FT   misc_feature    complement(order(387043..387102,387130..387198,
FT                   387256..387324,387418..387486,387523..387582,
FT                   387640..387708))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0387 by TMHMM2.0 at aa 12-34, 54-73, 86-108, 140-162,
FT                   182-204 and 214-233"
FT   CDS             387944..388546
FT                   /transl_table=11
FT                   /locus_tag="SUB0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41015"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ7"
FT                   /protein_id="CAR41015.1"
FT                   /translation="MVKNQFPLVADDMPVIESGRQMNLYENEDLISNIHGFYQDKDYND
FT                   VTRDYQPESQLQADSFNNGRQAVIDAGRSYAEEARKKARQDLKEKRQAYLSKELSYNPK
FT                   QSFQKSKVENPAEQRTRLRPENKWSRLTQKLGQDSYILAELPKQQPEPNTAADKKQAKN
FT                   NYDFLKRSQIYNSQETRIQREKSIAQELNLTRLDGVN"
FT   CDS             388583..389917
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SUB0389"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41017"
FT                   /db_xref="GOA:B9DTQ8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ8"
FT                   /protein_id="CAR41017.1"
FT                   /translation="MSSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGL
FT                   EKAGIEIKPFNKDNISEEMELIAGNAFRKDNNEELAYAIDNHIPFKRYHEFLGDFMKQF
FT                   ISFGVAGAHGKTSTTGLLSHVLKNITDTSFLIGDGTGRGSANAQYFVFESDEYERHFMP
FT                   YHPEYSIITNIDFDHPDYFTGIDDVFSAFNDYAKQVKKALFVYGEDEELKKISANAPIY
FT                   YYGFEDYNDFVAYDITRTTNGSDFKVKHKDNVIGSFHVPAYGKHNILNATAVIANLYIA
FT                   GIDMDLVAKHMLTFSGVKRRFTEKIINETIIIDDFAHHPTEIVATIDAARQKYPSKEIV
FT                   AIFQPHTFTRTIALLDDFAQALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKIIKPSK
FT                   VVTVENVSPLLDHDNAVYVFMGAGDIQLYERSFEELLANLTHNNQ"
FT   misc_feature    388709..389449
FT                   /gene="murC"
FT                   /locus_tag="SUB0389"
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain, score 3.9e-36"
FT                   /inference="protein motif:HMMPfam:PF01225"
FT   misc_feature    389474..389743
FT                   /gene="murC"
FT                   /locus_tag="SUB0389"
FT                   /note="HMMPfam hit to PF02875, Mur ligase family, glutamate
FT                   ligase doma, score 7e-21"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS             389962..390465
FT                   /transl_table=11
FT                   /locus_tag="SUB0390"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41018"
FT                   /db_xref="GOA:B9DTQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTQ9"
FT                   /protein_id="CAR41018.1"
FT                   /translation="MQIRHVREEDWRTVFAIESSNFSESEAATATVIEERTRVIPDTFL
FT                   VAELDQRVVGYIEGPVVKEPKLVDSLFHGACQNPETGGFVAVTSLSIDQAYQKQGIGTA
FT                   LIAALKDLVILQERQGIVLTCHDYLIAYYEMNGFENYGLSESEHGGSVWYDMVWKNPQL
FT                   LSSE"
FT   misc_feature    390094..390378
FT                   /locus_tag="SUB0390"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.4e-09"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS             390565..392334
FT                   /transl_table=11
FT                   /locus_tag="SUB0391"
FT                   /product="putative aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41020"
FT                   /db_xref="GOA:B9DTR0"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR0"
FT                   /protein_id="CAR41020.1"
FT                   /translation="MTDVKDDGQKTQKTMSFKEHILAELEKANQIRKEKEEELLKQGLE
FT                   EEELRIKEKEAQEAAKRTLELYREYQEEDLKSRQAQVYDDNQEKLVNETRSEEVDKDKQ
FT                   PESDIPTSDTSDASNAKDKTISDTYSNPIDKNRRGDSLEEKDFSETIPFTPITILDQSQ
FT                   LGNLEEVQHGEEMEQNDSNQSEGDVDHDRVTNKENQGSENPLLRAQSSKRHRADRVAKK
FT                   ISMMLISSILILIILGGLLATLFVYNAVNPVDKKDDKYVQVEVPMGSGNKLIGQLLEEK
FT                   GLIKSGTVFNFFTKFKNYGNFQSGYYNFQKSMSLEDIAKTLQKGGTDKPTKPALGKILI
FT                   TEGSTIKQMSVAISNNVNTKTTKDKTPFSAKEFLDTVQDEAFIKEMVKKYPRLLSSIPS
FT                   KSEAIYQLEGYLFPATYNYHKETRMKDLIDEMLATTDATLSPYYESIATSGKTVNDVLT
FT                   LASLVEKEGSTDGDRRDIASVFYNRLNNGMALQSNIAILYAMNKLGEKTTLAEDASIDT
FT                   TIKSPYNIYTNTGLMPGPVASPGLSAIDATIKPANTDYLYFVANVKTGEVFYAKTYEEH
FT                   SKNVEKYVNSQIQ"
FT   misc_feature    391231..391299
FT                   /note="1 probable transmembrane helix predicted for SUB0391
FT                   by TMHMM2.0 at aa 223-245"
FT   misc_feature    391345..392322
FT                   /locus_tag="SUB0391"
FT                   /note="HMMPfam hit to PF02618, Aminodeoxychorismate lyase,
FT                   score 4.2e-134"
FT                   /inference="protein motif:HMMPfam:PF02618"
FT   CDS             392403..392885
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SUB0392"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41021"
FT                   /db_xref="GOA:B9DTR1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTR1"
FT                   /protein_id="CAR41021.1"
FT                   /translation="MAEKTYPMTKAEKEQLEKELEELKLVRRPEVVERIKIARSYGDLS
FT                   ENSEYDAAKDEQAFVEGQISTLETQIRFAEIIDSDAVAKDEVAIGKTVVVQEVGTTDKD
FT                   TYHIVGSAGADIFSGKISNESPIAQALIGKKKGDIADIVSPATTYQVEIISVEKTK"
FT   misc_feature    392409..392630
FT                   /gene="greA"
FT                   /locus_tag="SUB0392"
FT                   /note="HMMPfam hit to PF03449, Prokaryotic transcription
FT                   elongation fact, score 2.1e-23"
FT                   /inference="protein motif:HMMPfam:PF03449"
FT   misc_feature    392646..392876
FT                   /gene="greA"
FT                   /locus_tag="SUB0392"
FT                   /note="HMMPfam hit to PF01272, Prokaryotic transcription
FT                   elongation fact, score 5.9e-18"
FT                   /inference="protein motif:HMMPfam:PF01272"
FT   misc_feature    392766..392816
FT                   /note="PS00830 Prokaryotic transcription elongation factors
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00830"
FT   CDS             complement(392969..393892)
FT                   /transl_table=11
FT                   /locus_tag="SUB0393"
FT                   /product="membrane protein OxaA 2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41025"
FT                   /db_xref="GOA:B9DTR2"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR2"
FT                   /protein_id="CAR41025.1"
FT                   /translation="MKIKLNRILFSGLALSILITLTGCVGRDAHGNPKGIIWDLLGKPM
FT                   SYFINYFANNVGLGFGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPIFDPIN
FT                   QKMKNATTQEEKLAAQTELMAAQRENGINMLGGMGCLPLLIQMPFFSAMYFAALHTKGI
FT                   STSTFMGIDLGSRSLVLTGIIAVLYYFQSWLSMQAVAEEQRAQMKTMMYTMPIMMIFMT
FT                   LSLPAGVGLYWLVGGFFSIIQQLITTYVLKPKLRQQIEEEFKNNPPKASKAGSTRKDVT
FT                   PSKNQAISTKANTNRKNRNAGKQKNR"
FT   misc_feature    complement(393137..393715)
FT                   /locus_tag="SUB0393"
FT                   /note="HMMPfam hit to PF02096, 60Kd inner membrane protein,
FT                   score 5e-36"
FT                   /inference="protein motif:HMMPfam:PF02096"
FT   misc_feature    complement(order(393179..393247,393308..393376,
FT                   393419..393487,393680..393748,393806..393874))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0393 by TMHMM2.0 at aa 7-29, 49-71, 136-158, 173-195 and
FT                   216-238"
FT   sig_peptide     complement(393800..393892)
FT                   /locus_tag="SUB0393"
FT                   /note="Signal peptide predicted for SUB0393 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(393976..394254)
FT                   /transl_table=11
FT                   /locus_tag="SUB0394"
FT                   /product="putative acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41026"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR3"
FT                   /protein_id="CAR41026.1"
FT                   /translation="MKKVRIIVSGKVQGVGFRYSTYALALEIGNIYGRVWNNDDGTVEI
FT                   LAQSQNSDKMAKFIQEIRKGPSKWAKVTYVDVKMDNFKDFHDFKMSN"
FT   misc_feature    complement(393994..394254)
FT                   /locus_tag="SUB0394"
FT                   /note="HMMPfam hit to PF00708, Acylphosphatase, score
FT                   2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00708"
FT   misc_feature    complement(394201..394233)
FT                   /note="PS00150 Acylphosphatase signature 1."
FT                   /inference="protein motif:Prosite:PS00150"
FT   CDS             394352..395089
FT                   /transl_table=11
FT                   /locus_tag="SUB0395"
FT                   /product="SpoU rRNA Methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41028"
FT                   /db_xref="GOA:B9DTR4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR4"
FT                   /protein_id="CAR41028.1"
FT                   /translation="MIISSKANPIIKKTKKLLQKKHRKNSYLIEGWHLFEEAQKSKQPI
FT                   LSVFLTEELENFKNSECPIYIVTPEVLKELTESPSPQGIVAEIAMPDSPLPLSQKGKYL
FT                   LLEDVQDPGNLGTMIRTADAACFDGVILSEKTVDLYNQKTLRSMQGSHFHLPVWRTDVY
FT                   SFCQTIQSNGVPVLATTLSKDSIDYKALPQNDSFVLVMGNEGRGISDEMAALANQLVHI
FT                   NMPGQAESLNVAVAAGILIFSLI"
FT   misc_feature    394652..395077
FT                   /locus_tag="SUB0395"
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00588"
FT   CDS             395126..395626
FT                   /transl_table=11
FT                   /locus_tag="SUB0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41031"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR5"
FT                   /protein_id="CAR41031.1"
FT                   /translation="MEYNQDQEFMELVGQLIEHPRFQKLESIVQHHHSTRFEHSINVAY
FT                   TSYKLAKRFGWDERSTARGGLLHDFFYYDWRVTKFKKSHAWVHPRIALRNAKKLTDINK
FT                   REEDIILKHMWGATVAFPRYKESYIVTMVDKYWAVKEAATPMRNRWANRRLFRRKTLNS
FT                   HNR"
FT   CDS             395642..396331
FT                   /transl_table=11
FT                   /locus_tag="SUB0397"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41032"
FT                   /db_xref="GOA:B9DTR6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR6"
FT                   /protein_id="CAR41032.1"
FT                   /translation="MNDNVIYTETDAGLNRFFAKIYSLVGMGVGLSAFVSYLMLFPFRE
FT                   NLISIISQHPFVYYGAAAVELILVFIASSAAQRNTPMALPLFLIYSALNGFTLSFIIAA
FT                   YTGTTVLEAFVSSAAVFFAMAFIGARVKKDLSGMRKAMMAALIGIILASVINIFMGSGT
FT                   MSFIISIISVLIFSGLIASDNQMIKRVYEANNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RIFGRND"
FT   misc_feature    395669..396328
FT                   /locus_tag="SUB0397"
FT                   /note="HMMPfam hit to PF01027, Uncharacterised protein
FT                   family UPF0005, score 6.9e-18"
FT                   /inference="protein motif:HMMPfam:PF01027"
FT   misc_feature    order(395702..395770,395813..395869,395888..395956,
FT                   395966..396034,396071..396169,396248..396316)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0397 by TMHMM2.0 at aa 21-43, 58-76, 83-105, 109-131,
FT                   144-176 and 203-225"
FT   CDS             396441..397679
FT                   /transl_table=11
FT                   /locus_tag="SUB0398"
FT                   /product="pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41034"
FT                   /db_xref="GOA:B9DTR7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTR7"
FT                   /protein_id="CAR41034.1"
FT                   /translation="MKKPFISKEKLEDMTSQYPTPFHLYDEAGIRQKAREVNKAFSWNK
FT                   GFKEYFAVKATPTPAILKILQEENCGVDCATEVELMMSHELGFKDIMFSSNNTPAREYQ
FT                   YAQEVGATINLDAYEQIAYLEETSGLPEKISLRYNPGGVFALGTDIMDHPQDSKFGMTK
FT                   EQLFQGYKELKAKGVKEFGIHSFLASNTVTNDYYPQLARQLFQLAVQIKEELDISLSFI
FT                   NLSGGIGVNYLPDQKENDIAQIGLGVKKAFEEILVPNNLGHISIYTELGRFMLAPHGHL
FT                   ITRVLHRKKTYKDYIGVDASAVNLLRPAMYGSYHHITNISNPDGEVELVDVVGSLCENN
FT                   DKFAKDRELPQARPGDLLVIHDTGAHGFSMGYQYNGRLRSAEMLLEESGQVRMIRRAET
FT                   PEDYFSTIRGFEF"
FT   misc_feature    396516..397271
FT                   /locus_tag="SUB0398"
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, py, score 4.4e-16"
FT                   /inference="protein motif:HMMPfam:PF02784"
FT   misc_feature    397278..397598
FT                   /locus_tag="SUB0398"
FT                   /note="HMMPfam hit to PF00278, Pyridoxal-dependent
FT                   decarboxylase, C-, score 5.4e-43"
FT                   /inference="protein motif:HMMPfam:PF00278"
FT   CDS             397778..398017
FT                   /transl_table=11
FT                   /locus_tag="SUB0399"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41035"
FT                   /db_xref="GOA:B9DTR8"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTR8"
FT                   /protein_id="CAR41035.1"
FT                   /translation="MSTAIWILLIVLALIGGLFGGVFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIVKQSKAAAAKGK"
FT   misc_feature    397787..397855
FT                   /note="1 probable transmembrane helix predicted for SUB0399
FT                   by TMHMM2.0 at aa 4-26"
FT   misc_feature    397799..397990
FT                   /locus_tag="SUB0399"
FT                   /note="HMMPfam hit to PF03672, Uncharacterised protein
FT                   family (UPF0154), score 1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF03672"
FT   CDS             398174..398968
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /gene_synonym="murI"
FT                   /locus_tag="SUB0400"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41037"
FT                   /db_xref="GOA:B9DTR9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTR9"
FT                   /protein_id="CAR41037.1"
FT                   /translation="MDNRPIGFLDSGVGGLTVVRELMRQLPHESIVYVGDSARAPYGPR
FT                   PADQIREFTWELVNFLLTKNVKMIVFACNTATAVAWEEVKNALSIPVLGVILPGSSAAI
FT                   KSTTSGKVGVIGTPMTIQSDIYRQKIQLLAPQIEVLSLACPKFVPIVESNETKSSVAKK
FT                   IVYETLEPLVGKVDTLVLGCTHYPLLRPIIQNVMGSEVTLIDSGAECIRDISVLLNYFQ
FT                   INASREEKKADNLFFTTAGTDTFKEIANAWLEESIDVEHTDL"
FT   misc_feature    398186..398830
FT                   /gene="glr"
FT                   /gene_synonym="murI"
FT                   /locus_tag="SUB0400"
FT                   /note="HMMPfam hit to PF01177, Asp/Glu/Hydantoin racemase,
FT                   score 1.5e-101"
FT                   /inference="protein motif:HMMPfam:PF01177"
FT   misc_feature    398708..398740
FT                   /note="PS00924 Aspartate and glutamate racemases signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00924"
FT   CDS             398965..399966
FT                   /transl_table=11
FT                   /locus_tag="SUB0401"
FT                   /product="HAM1 protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41039"
FT                   /db_xref="GOA:B9DTS0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS0"
FT                   /protein_id="CAR41039.1"
FT                   /translation="MSEKIYEYKDDKNWFIGKWQGYNTIKRLGHGISQDLDSLSSRLSQ
FT                   FNTNDIEDNWESFGYDVVIVTKDQESDVELVAFVLDMINQECHRHLRVTHFQGAHLIVE
FT                   DDKLYDIFLPKSGISADAFQDDNKLMWDDTILIATHNKGKTKEFAELFGQLGYKVQDLN
FT                   DFPDLPEVEETGITFEENARLKAETISNLTGKMVIADDSGLKVDVLGGLPGVWSARFSG
FT                   PEANDDKNNAKLLHELAMVFDQKARSAQFHSTLVVAAPEKESLVVEADWPGYIAFQPKG
FT                   DNGFGYDPLFIVGETGKHAAELLPEEKNQISHRGLAFKKLMEVFPEWQRKQQ"
FT   misc_feature    399367..399939
FT                   /locus_tag="SUB0401"
FT                   /note="HMMPfam hit to PF01725, Ham1 family, score 2.3e-75"
FT                   /inference="protein motif:HMMPfam:PF01725"
FT   misc_feature    399376..399399
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             399945..400469
FT                   /transl_table=11
FT                   /locus_tag="SUB0402"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41040"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS1"
FT                   /protein_id="CAR41040.1"
FT                   /translation="MAKKTTIIVMSDSHGDREVVESIKNRYLDQVDAIFHNGDSELRST
FT                   DPIWDGIHVVAGNCDYDSSYPQKLVVQLDSYVIAQTHGHLYNINFTWDKLDYFARESQA
FT                   DICLYGHLHRPAAWQIGQTIFVNPGSVLQPRGDINEKLYAKIEMTEKTITVDYFDLNHS
FT                   LYPSLSKEFER"
FT   misc_feature    399972..400289
FT                   /locus_tag="SUB0402"
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 2.1e-06"
FT                   /inference="protein motif:HMMPfam:PF00149"
FT   CDS             400466..400933
FT                   /transl_table=11
FT                   /locus_tag="SUB0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41043"
FT                   /db_xref="GOA:B9DTS2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS2"
FT                   /protein_id="CAR41043.1"
FT                   /translation="MIAKEFESFILQHLDSYLIPADDLAIFIDTHNSDHVMLILVSNGF
FT                   SRVPVISKDKIFKGTISISDILNYQAKHQLTDWELNQTDIGEMVNTKIESISFKSSLTL
FT                   IMHKLVEYPFLPVVDDENHFIGIITRKSILKAVNSLLHDFTNDYTIEKKHD"
FT   misc_feature    400517..400678
FT                   /locus_tag="SUB0403"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    400724..400879
FT                   /locus_tag="SUB0403"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   CDS             400926..401669
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="SUB0404"
FT                   /product="tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41045"
FT                   /db_xref="GOA:B9DTS3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTS3"
FT                   /protein_id="CAR41045.1"
FT                   /translation="MIKHIEAFLASKTISENTLKSYRYDLNQFLMLIDHKLSDEKLVLY
FT                   QKSLNHLSASAKKRKFSTVNQFLHYLYKVNVTDRFFELSGKVSLPSTKVPFTYQLDDKR
FT                   FYQKTQHPSGQLIALLILELGLLPSELSKLRLSEIDLDFQLIRVDNGSTVKVLSFSQAI
FT                   LKHLSEMEVGSTYLFENKGKPYSRQWFFNQLNAFLLEIGYDQLSAQSLREQFIIREKEK
FT                   GTSLMELTQKLGLKSPITLEKYYRL"
FT   misc_feature    400938..401153
FT                   /gene="xerD"
FT                   /locus_tag="SUB0404"
FT                   /note="HMMPfam hit to PF02899, Phage integrase, N-terminal
FT                   SAM-like d, score 0.0091"
FT                   /inference="protein motif:HMMPfam:PF02899"
FT   CDS             401669..402376
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="SUB0405"
FT                   /product="segregation and condensation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41047"
FT                   /db_xref="GOA:B9DTS4"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTS4"
FT                   /protein_id="CAR41047.1"
FT                   /translation="MDIKINDFEGPLDLLLHLVSKYQMDIYQVPIVAVIEQYLAYIETL
FT                   QAMKLEVAGEYMVMASQLMLIKSRRLLPTITEVSSEELDPEEDLLSKIEEYSRFKELSQ
FT                   QLGYQHDQRALLFSKPKQELIFEDAVLNEDKSITDLFLAFSKIMAIKQEEVKNNHTVIE
FT                   RDDFRIEDMMDHLDTVLNAKTEITLSEVFKDCTSINEVITMFLATLELIKIQAVTVFQE
FT                   DNFSDIILRKENR"
FT   misc_feature    401720..402367
FT                   /gene="scpA"
FT                   /locus_tag="SUB0405"
FT                   /note="HMMPfam hit to PF02616, Uncharacterised ACR,
FT                   COG1354, score 1.4e-22"
FT                   /inference="protein motif:HMMPfam:PF02616"
FT   CDS             402373..402927
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="SUB0406"
FT                   /product="segregation and condensation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41049"
FT                   /db_xref="GOA:B9DTS5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS5"
FT                   /protein_id="CAR41049.1"
FT                   /translation="MTSYLAQIEALLFVAGEEGLSLRSLASMINVSPTAIQQQLEKLAE
FT                   KYQEDDQSAICLLETSQTYKLVTKEEHASLLRDFAKAPINLSLSRATLEVLSIIAYKQP
FT                   ITRLEIDEIRGVNSSGALSKLIAFELVKESGKKEVVGRPNLYVTTDYFLDFMGINHLDQ
FT                   LIDVSTIEIQNQETALFQNKD"
FT   misc_feature    402388..402873
FT                   /gene="scpB"
FT                   /locus_tag="SUB0406"
FT                   /note="HMMPfam hit to PF04079, Putative transcriptional
FT                   regulators (Ypuh-li, score 2.3e-71"
FT                   /inference="protein motif:HMMPfam:PF04079"
FT   misc_feature    402430..402495
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1485.000, SD 4.24 at aa 20-41, sequence
FT                   LSLRSLASMINVSPTAIQQQLE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             402960..403682
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="SUB0407"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41051"
FT                   /db_xref="GOA:B9DTS6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS6"
FT                   /protein_id="CAR41051.1"
FT                   /translation="MRINKYIAHAGVASRRKAEELIKQGLVTLNGQVVSDLATTVKSGD
FT                   TVEVEGSPIYNEEKVYYLLNKPRGVISSVSDDKGRKTVIDLLPQVKERIYPVGRLDWDT
FT                   SGLLILTNDGDFTDKMIHPRNEIDKVYLARVKGIATKDNLRPLTRGVVIDGKKTKPARY
FT                   NIIRVEADKNRSIVELTIHEGRNHQVKKMFESVGLIVDKLSRTRFGTLDLTGLRPGESR
FT                   RLNKKEISQLHNAAVTDK"
FT   misc_feature    402960..403115
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    402960..403100
FT                   /gene="rluB"
FT                   /locus_tag="SUB0407"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 7.9e-16"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    403137..403544
FT                   /gene="rluB"
FT                   /locus_tag="SUB0407"
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 1.6e-25"
FT                   /inference="protein motif:HMMPfam:PF00849"
FT   misc_feature    403251..403295
FT                   /note="PS01149 Rsu family of pseudouridine synthase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01149"
FT   CDS             403682..403930
FT                   /transl_table=11
FT                   /locus_tag="SUB0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41053"
FT                   /db_xref="GOA:B9DTS7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTS7"
FT                   /protein_id="CAR41053.1"
FT                   /translation="MKSIIINFVRLYQKWISPLFPPSCRYRPTCSTYMIEAVEKHGIKG
FT                   VLMGIARILRCHPFVEGGEDPVPDEFTLRRNPQKGKK"
FT   misc_feature    403682..403882
FT                   /locus_tag="SUB0408"
FT                   /note="HMMPfam hit to PF01809, Domain of unknown function
FT                   DUF37, score 2e-35"
FT                   /inference="protein motif:HMMPfam:PF01809"
FT   CDS             404123..404668
FT                   /transl_table=11
FT                   /locus_tag="SUB0409"
FT                   /product="SpoU rRNA methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41054"
FT                   /db_xref="GOA:B9DTS8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS8"
FT                   /protein_id="CAR41054.1"
FT                   /translation="MPVDVENLTYRERKSKNHVVLFEPQIPQNTGNIARTCAATNAPLH
FT                   IIKPMGFPIDDRKMRRAGLDYWDKLDVRFYDSLDDFVEKCDGKLHLISKFAETVYSDER
FT                   FDDGENHYYLFGREDKGLPETFMRKHPEKALRIPMNDEHVRSLNLSNTVCMIVYEALRQ
FT                   QSFEGLELTHTYAQDKLK"
FT   misc_feature    404168..404596
FT                   /locus_tag="SUB0409"
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 3.8e-38"
FT                   /inference="protein motif:HMMPfam:PF00588"
FT   misc_RNA        404843..404967
FT                   /note="FMN riboswitch (RF00050) as predicted by Rfam, score
FT                   131.88"
FT   CDS             405045..405608
FT                   /transl_table=11
FT                   /locus_tag="SUB0410"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41056"
FT                   /db_xref="GOA:B9DTS9"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTS9"
FT                   /protein_id="CAR41056.1"
FT                   /translation="MSKTHRLVMVAILSAISFLLMFFSFSIIPGADFLKIELSIIPVLL
FT                   GLVLMDLKSAYAILILRSLLKLILNNSGVNDFIGLPMNILALGIFVTVFAVIWNNQKTL
FT                   KQYIGASLIGTLSLTTAMLAFNYFYAIPLYAKFANFDIAAFIGIAKYLLAMVLPFNIIE
FT                   GFIFAISFYIVYIASKPVLERYTN"
FT   sig_peptide     405045..405137
FT                   /locus_tag="SUB0410"
FT                   /note="Signal peptide predicted for SUB0410 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.735 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(405063..405131,405273..405341,405378..405446,
FT                   405504..405572)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0410 by TMHMM2.0 at aa 7-29, 77-99, 112-134 and 154-176"
FT   CDS             405612..406262
FT                   /transl_table=11
FT                   /locus_tag="SUB0411"
FT                   /product="PAP2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41059"
FT                   /db_xref="GOA:B9DTT0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT0"
FT                   /protein_id="CAR41059.1"
FT                   /translation="MKNKQDYFIRSSFAFLFFVMLGYTVRFYPMSLVTFDDTIQNAVRG
FT                   NLPNSFTLFFKHVTVLGNVLSQVMLVASLSLIFYLKKWKAEALFLLTNGLMSGLVVMIF
FT                   KLIYQRLRPSLEHIVYAGGFSFPSGHALGSMMIYGALLIIFLGRVTNKKWRYLLVSFMT
FT                   GLILLIGISRIYLGVHYPTDVIGGFVCGFGFLNLFFPYYQEKRFKWRFQSKQE"
FT   misc_feature    order(405630..405698,405783..405851,405870..405938,
FT                   405996..406052,406071..406139,406149..406217)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0411 by TMHMM2.0 at aa 7-29, 58-80, 87-109, 129-147,
FT                   154-176 and 180-202"
FT   misc_feature    405822..406232
FT                   /locus_tag="SUB0411"
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily, score
FT                   3.7e-28"
FT                   /inference="protein motif:HMMPfam:PF01569"
FT   CDS             406321..407241
FT                   /transl_table=11
FT                   /locus_tag="SUB0412"
FT                   /product="radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41060"
FT                   /db_xref="GOA:B9DTT1"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT1"
FT                   /protein_id="CAR41060.1"
FT                   /translation="MKKRYNTLNDYYRQLFGQKIFKVPIDAGFDCPNRDGTVAHGGCTF
FT                   CTVSGSGDAIVAPDAPIREQFYKEIDFMHRKWPEVSQYLVYFQNFTNTHAPVEVIKERY
FT                   EQAINEPGVVGINIGTRPDCLPDETIAYLAELSQRMHVTVELGLQTTYETTSKLINRAH
FT                   SYDLYKETVKRLRKYPKIEIVSHLINGLPGETAEMMIENVRRCVTDNDIQGIKLHLLHL
FT                   MTNTRMQRDFHEGRLQLLSQEEYVSIICDQLEIIPQNIIIHRITGDAPREMLIGPMWSL
FT                   NKWEVLNAIDLEMERRGSFQGCRLL"
FT   misc_feature    406393..406938
FT                   /locus_tag="SUB0412"
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 6.3e-12"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   misc_feature    407227..407238
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   CDS             407277..408113
FT                   /transl_table=11
FT                   /locus_tag="SUB0413"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41061"
FT                   /db_xref="GOA:B9DTT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT2"
FT                   /protein_id="CAR41061.1"
FT                   /translation="MAENIITIDHLSKSYGRHLALDQLSLTVEKGEIFGFLGSNGAGKS
FT                   TTIRCLLGLIKYRKGKVTLFNDRYHSLEESLDHIGYMPSEAMFYPNMTVKQVIDFAAKA
FT                   HPNHDCKREADRLCKLLEVPLQKKIQDLSLGNRKKVSIVCALQHQPDLLILDEPTSGLD
FT                   PLMQERFFQIILDAKEKGKTCFLSSHVLSEVKAYCDRVAILKKGKLLAVDRVENIMHSQ
FT                   KKQVTIWKDGQSITKTFEGKLSDLLSDLSEIKPDDLLIEEPSLEDLFMHYYKEDVK"
FT   misc_feature    407367..407897
FT                   /locus_tag="SUB0413"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.7e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    407388..407411
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    407670..407714
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             408110..408892
FT                   /transl_table=11
FT                   /locus_tag="SUB0414"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT3"
FT                   /protein_id="CAR41063.1"
FT                   /translation="MIRHELRQGRKSLLIWAICVGLSSALCILLYESVADSIKEIANLY
FT                   QNMGGVSKALGMDKVSIATLGGYYASEIALIYSIGAAMYATMIGISLLSKEEEAHTAEF
FT                   LFSLPIGRAKILRQKFVSILFSLIIFNGIAISIEYLALVKVNMSFDYGAFASYHLLVFL
FT                   LQVEMASFSFMISAFSRKKLIGFGMGLALMGYFMDIICRLVDKVDYLKYVTPFYYANAT
FT                   NRFAGETLDWLMLVIAVSVIVISYLIAHIVFRNRDLAS"
FT   sig_peptide     408110..408214
FT                   /locus_tag="SUB0414"
FT                   /note="Signal peptide predicted for SUB0414 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975) with cleavage site
FT                   probability 0.620 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(408146..408214,408326..408385,408470..408538,
FT                   408566..408634,408653..408721,408803..408871)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0414 by TMHMM2.0 at aa 13-35, 73-92, 121-143, 153-175,
FT                   182-204 and 232-254"
FT   CDS             408902..409447
FT                   /transl_table=11
FT                   /locus_tag="SUB0415"
FT                   /product="putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41065"
FT                   /db_xref="GOA:B9DTT4"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT4"
FT                   /protein_id="CAR41065.1"
FT                   /translation="MKKPIQMSHDFLEEWVTKDSIFVDATVGNGNDTLYFAPLVKKVYA
FT                   FDIQKEAISRTQQKLEANGIENVILIHDGHENVNHYVQDIDAAIFNLGYLPHSDKKIVT
FT                   KSSTTLQAIEKIYERLVKGGRIALMVYYGHDGGEEEKDAILQYLSTMDQKQTTVMVYQS
FT                   LNQVNCPPYLVMIEKLAN"
FT   misc_feature    409025..409435
FT                   /locus_tag="SUB0415"
FT                   /note="HMMPfam hit to PF06962, Putative rRNA methylase,
FT                   score 5.6e-81"
FT                   /inference="protein motif:HMMPfam:PF06962"
FT   CDS             409566..410900
FT                   /transl_table=11
FT                   /locus_tag="SUB0416"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41067"
FT                   /db_xref="GOA:B9DTT5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT5"
FT                   /protein_id="CAR41067.1"
FT                   /translation="MEDPVSQPLYFQLLLLIFFTILNAFFSASEMALVSLNRSRVEQKA
FT                   ADGDKKYIRLLNVLDKPNHFLSTIQVGITFISLLQGASLSASLGEVISGWLGGSATAQT
FT                   AGTVISLIFLTYISIVLGELYPKRIAMNLKDKLAIISAPVIIVLGKIVSPFVWLLSAST
FT                   NLLSRITPMTFDDADEQMTRDEIEYMLTNSEATLDAEEIEMLQGIFSLDELMAREVMVP
FT                   RTDAFMIDINDDTLENIQEILKQSFSRIPVYDVDKDKVIGLVHTKRLLEAGFKKGFENI
FT                   NMRRILQEPLFVPETIYVDDLLRQLRITQNQMAILLDEYGGVAGLVTLEDLLEEIVGEI
FT                   DDETDKAEQFVHVIGEDTYIVVGTMTLNEFNEYFETELESDDVDTIAGFYITGIGTIPS
FT                   QEDKKPFEYESNGKHLTLINDKVKDGRITKLKLLVSNIEQIIEED"
FT   misc_feature    409596..410168
FT                   /locus_tag="SUB0416"
FT                   /note="HMMPfam hit to PF01595, Domain of unknown function
FT                   DUF21, score 2e-73"
FT                   /inference="protein motif:HMMPfam:PF01595"
FT   misc_feature    order(409608..409676,409776..409844,409872..409940,
FT                   409974..410042)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0416 by TMHMM2.0 at aa 15-37, 71-93, 103-125 and
FT                   137-159"
FT   misc_feature    410223..410387
FT                   /locus_tag="SUB0416"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    410415..410576
FT                   /locus_tag="SUB0416"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 9.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    410619..410873
FT                   /locus_tag="SUB0416"
FT                   /note="HMMPfam hit to PF03471, Transporter associated
FT                   domain, score 2e-18"
FT                   /inference="protein motif:HMMPfam:PF03471"
FT   CDS             410977..411768
FT                   /transl_table=11
FT                   /gene="pflC"
FT                   /locus_tag="SUB0417"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41070"
FT                   /db_xref="GOA:B9DTT6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT6"
FT                   /protein_id="CAR41070.1"
FT                   /translation="MEEIDYGQVTGMIHSTESFGSVDGPGIRFIIFMQGCKMRCQYCHN
FT                   PDTWEMETNKSRERTVSDVLKEALQYRHFWGKNGGITVSGGEAMLQIDFITALFIEAKK
FT                   LGIHTTLDTCGFAYRPTPEYHQILDKLLAVTDLILLDLKEIDEEQHKIVTRQPNKNILL
FT                   FAHYLSDKGIPVWIRHVLVPGLTDIDEHLERLGDFVAKLKNVDKFEILPYHTMGEFKWR
FT                   ELGIPYPLEGVKPPTKERVQNAKTIMKTESYTEYMNRIHRS"
FT   misc_feature    411046..411111
FT                   /note="PS01087 Radical activating enzymes signature."
FT                   /inference="protein motif:Prosite:PS01087"
FT   misc_feature    411064..411564
FT                   /gene="pflC"
FT                   /locus_tag="SUB0417"
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 6e-31"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   misc_feature    411094..411111
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS             411883..412818
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="SUB0418"
FT                   /product="manganese-dependent inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41072"
FT                   /db_xref="GOA:B9DTT7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTT7"
FT                   /protein_id="CAR41072.1"
FT                   /translation="MSKVLVFGHQNPDTDAIASSYAFAYLAKNAYKMDAEVVALGEPNE
FT                   ETAFALDYFGVTAPRVVESAKAEGVDTVILTDHNEFQQSLSDISDVTIFGVVDHHRVAN
FT                   FETANPLFMRVEPVGSASSIVYRMYKENNLEVPKEIAGLLLSGLISDTLLLKSPTTHMT
FT                   DHKVAEELANLAGVNLDEYGMSLLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVN
FT                   TVDIAEVLERQDAIETAISDAIVKEGYSDFVLMITDIVNSNSEILALGSNMDKVEAAFN
FT                   FKLENNHAFLPGAVSRKKQVVPQLTESFGA"
FT   misc_feature    411883..412329
FT                   /gene="ppaC"
FT                   /locus_tag="SUB0418"
FT                   /note="HMMPfam hit to PF01368, DHH family, score 1.3e-17"
FT                   /inference="protein motif:HMMPfam:PF01368"
FT   misc_feature    412429..412809
FT                   /gene="ppaC"
FT                   /locus_tag="SUB0418"
FT                   /note="HMMPfam hit to PF02833, DHHA2 domain, score 3.5e-51"
FT                   /inference="protein motif:HMMPfam:PF02833"
FT   CDS             412820..413284
FT                   /transl_table=11
FT                   /locus_tag="SUB0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41074"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT8"
FT                   /protein_id="CAR41074.1"
FT                   /translation="MSYIVNFKTVETSLLEESPVKDVLAGLRANEARYFWNKYKIEYEV
FT                   FTPEERPEILPFIESVLAERDMVFPYKALCVSQMEVDGINWSHVYYENGLAVNVLYTLA
FT                   EGGKRAVGFKLSNGIEIPKEFEGKFKFARQRSKLAGEIRGTFFVVKGSYL"
FT   CDS             413349..414002
FT                   /transl_table=11
FT                   /locus_tag="SUB0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41077"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTT9"
FT                   /protein_id="CAR41077.1"
FT                   /translation="MLTIINPNKMTKDPFFLNLVNYLDSESDVTLRQLKKAFSHIPNLD
FT                   RKLDNYIKEGFVSRANRRYQLMLPALPEWSELRLDQMLLLSTTSPFYQTLQELEFVTEL
FT                   CNQTNECLILEKTRFERQELSLSNYFYKLKNGYKLSPEQEPLYALLGDVNPEYALKYMS
FT                   SFLLKCLKKDSFKQKRPDIFCQALLILGYLKEVDFQTYALNMAVDKERFIFTAF"
FT   CDS             complement(414019..415026)
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SUB0421"
FT                   /product="ferrichrome transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41078"
FT                   /db_xref="GOA:B9DTU0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU0"
FT                   /protein_id="CAR41078.1"
FT                   /translation="MKKQKLFYFGICLSLILILLILLSLSIGDSSFSIHVVWDCLFGKA
FT                   SPAMTFIITKIRLPRILACLFGGASLALAGNLLQTLTRNPLADSGILGINAGAGFMIAL
FT                   LISHGKGDNSLNMAFLPLLATLGALLTLVLVYMASLSKQKTIQPTALIITGVGFSMMLS
FT                   SLMIAVVGHVNRYKVDYVLNWLSGRIIGDDWNAILLTAPLLVLLWGFTYSKSYTLNILL
FT                   MSDDMATALGMNVQRERKIILALATCLAAISVTLIGNITFIGLIAGHVSRYFIGDDHRL
FT                   NLPLSLLLGMIFLLLADTLTRVFLVGSNIPTGIIISLLGAPYFLYLMQEKTKKS"
FT   misc_feature    complement(414040..414945)
FT                   /gene="fhuG"
FT                   /locus_tag="SUB0421"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,
FT                   score 7.3e-81"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(order(414049..414117,414136..414189,
FT                   414232..414300,414361..414429,414508..414576,
FT                   414610..414678,414706..414774,414793..414861,
FT                   414940..415008))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0421 by TMHMM2.0 at aa 7-29, 56-78, 85-107, 117-139,
FT                   151-173, 200-222, 243-265, 280-297 and 304-326"
FT   sig_peptide     complement(414928..415026)
FT                   /gene="fhuG"
FT                   /locus_tag="SUB0421"
FT                   /note="Signal peptide predicted for SUB0421 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.879 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(415023..416042)
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SUB0422"
FT                   /product="ferrichrome transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41079"
FT                   /db_xref="GOA:B9DTU1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU1"
FT                   /protein_id="CAR41079.1"
FT                   /translation="MTDTNQTSLKQPKSFWLVFFTLGLLFFIVGYVSLRFGAVTFSHDT
FT                   LGDIIQNPTDRSRLTLTFLNIRLPRVLATIIVGAALAVSGAVMQGITRNPIADPGLLGI
FT                   NSGAGLGLVVAYAFFHQLHYTSIILVCLSGSILASLMVFSLSYQIGKGYQQLRLILAGA
FT                   MVSTFLTALGQAITTYFQLANRIIGWQAGGFVAVNWQMLYHIAPIIGFGLIMTQLLAHQ
FT                   LTILSLSETRSKALGQNTLLLTLIFMALVLLMASASVALAGNISFLGLIIPHFVKALFP
FT                   STYQRRLPLIAISGATFMMAVDLICRTINPPYETPLTAVISLVGLPVFLWLVRKGGRE"
FT   misc_feature    complement(415038..415934)
FT                   /gene="fhuB"
FT                   /locus_tag="SUB0422"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,
FT                   score 2.1e-77"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(order(415044..415100,415128..415181,
FT                   415239..415307,415398..415466,415503..415571,
FT                   415599..415667,415686..415745,415773..415841,
FT                   415932..416000))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0422 by TMHMM2.0 at aa 15-37, 68-90, 100-119, 126-148,
FT                   158-180, 193-215, 246-268, 288-305 and 315-333"
FT   CDS             complement(416053..416988)
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SUB0423"
FT                   /product="putative ferrichrome-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41081"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU2"
FT                   /protein_id="CAR41081.1"
FT                   /translation="MKKLLVTLVLIFSTLSLIACSSQSTKQEDHKTKLSQMPKISGFTY
FT                   KGKVPENPKRVVSLSSTYTGYLAKLDIPLVGITSYDHKNPVLKKYIKDAKVVSATDLES
FT                   ITALEPDLIIVGSNEENISQLAEIAPLISIEYRKHDYLQVFSDFGKVFNKTKETDKWLQ
FT                   EWKTKTASFESDVKAVTGNNATFTIMGLYEKDIYLFGKDWGRGGEIIHQAFQYQAPEKV
FT                   KMEVFPKGYLSISQEVLPDYIGDYVVVAAEDEKTGSSLYESDLWKNIPAVQKNHVINVN
FT                   ANTFYFTDPLSLEYELKTLTDAILTQKTHN"
FT   misc_feature    complement(416137..416832)
FT                   /gene="fhuD"
FT                   /locus_tag="SUB0423"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 1e-35"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   sig_peptide     complement(416926..416988)
FT                   /gene="fhuD"
FT                   /locus_tag="SUB0423"
FT                   /note="Signal peptide predicted for SUB0423 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.769 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(416929..416961)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(417013..417795)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SUB0424"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41083"
FT                   /db_xref="GOA:B9DTU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU3"
FT                   /protein_id="CAR41083.1"
FT                   /translation="MSTINANHLSVAYDQKVIINDLTINLPSQKITSLIGSNGCGKSTL
FT                   LKALTRIIPNQKGNILIDGQDIAKMPTMEIAKKMALLPQVQDITDGISVYELVSFGRYP
FT                   YQSRLGKLTEDDKKIIDWALEMTKTQELANQLVDQLSGGQKQRVWIAMALAQDTPLIFL
FT                   DEPTTYLDINHQLEILELLRSLNKESQKTIIMVLHDLNLASRYSDYLVSIKDGKIAYQG
FT                   DPSEIMTPEIIRDIFGIEAHLTQDPIYNCPILLSYKLI"
FT   misc_feature    complement(417148..417711)
FT                   /gene="fhuC"
FT                   /locus_tag="SUB0424"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.9e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(417334..417378)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(417667..417690)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(418000..419448)
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SUB0425"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41085"
FT                   /db_xref="GOA:B9DTU4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU4"
FT                   /protein_id="CAR41085.1"
FT                   /translation="MITIEKTIELLKKDHNFREVIHQEHYYFNYSGLSFQKLSYDSREV
FT                   DADTLFFAKGAQFKVDYLKKAIDQGLQAYVSEIDYQLSIPAIIVSDIKKAMSIIAMTFY
FT                   GNPQEKLKLLAFTGTKGKTTAAYFAYHILKQNYKPAMFSTMNTTLDGQTFFKSQLTTPE
FT                   SLDLFKMMASCVSNGMTHIIMEVSSQAYLVDRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFNILAEQVADKDHVFYGDQSENALTESQAFAFSV
FT                   NGQIAGHYDIQLIGRFNQENAIAAGLACQKLGASHLDIHEGIAQTTVPGRMEVVSHPNG
FT                   AKVFVDYAHNGDSLEKLVSVVETHQKGLISLIIGSTGNKGESRRADFGRVINNHPNLNV
FT                   ILTADDPNFEDPETICQEIASHVNRHVSIIVDRQDAIIEGLKYCHTSGDALIIAGKGAD
FT                   AYQIVNGKKEEYAGDLAIAKKALS"
FT   misc_feature    complement(418198..418467)
FT                   /gene="murE"
FT                   /locus_tag="SUB0425"
FT                   /note="HMMPfam hit to PF02875, Mur ligase family, glutamate
FT                   ligase doma, score 2e-12"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   misc_feature    complement(418489..419289)
FT                   /gene="murE"
FT                   /locus_tag="SUB0425"
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain, score 6e-26"
FT                   /inference="protein motif:HMMPfam:PF01225"
FT   CDS             419536..421173
FT                   /transl_table=11
FT                   /locus_tag="SUB0426"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41087"
FT                   /db_xref="GOA:B9DTU5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU5"
FT                   /protein_id="CAR41087.1"
FT                   /translation="MSKNRNDLTQEELMLQGTVWSTVSNFTSRLLGVIYVIPWFMWMGE
FT                   HATQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMEQEEHSYQLIRGTLKLMV
FT                   VLGLIFSAIMYITAPVFAKLSGSDQQLIPIMHSLSLAVLVFPTMSVIRGIFQGYNNLKP
FT                   SALSQIAEQIIRVIWMLSTTFAIMKLGSGDYLKAVTQSTFAAFIGMIASMAVLIYYLKQ
FT                   QGLLKVIFSKPQLETPIDTKGLLIETLKESIPFIVIGSAIQLFQLIDQWTFTNTMLLFT
FT                   QYTRAQLLILFGYFNANPAKITMILIAVAASIGGVGIALLTENYVKKDMKASAKLIINN
FT                   IVMLLMFILPALTGAIILARPLYSVFYGFSEAQAISLFRAVLLQTLLLAFYSLLAPMLQ
FT                   ALFENRRALTYFAYGILIKLVFQVPCIYLFHAYGPLLATTLGLLVPIYLMFRRLHQVTK
FT                   FNRKLLFKQSLLILILTGIMGLFVAIANWLLGFAFVPTGRLSSLLYLLIVGTFGMLIYG
FT                   YLTLVTRQLDKLIGEKAETLRKKLRINV"
FT   misc_feature    419575..420510
FT                   /locus_tag="SUB0426"
FT                   /note="HMMPfam hit to PF01943, Polysaccharide biosynthesis
FT                   protein, score 2.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01943"
FT   misc_feature    order(419596..419664,419707..419766,419833..419901,
FT                   419929..419997,420055..420108,420136..420195,
FT                   420289..420357,420439..420507,420541..420609,
FT                   420652..420720,420754..420807,420817..420885,
FT                   420940..421008,421036..421104)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SUB0426 by TMHMM2.0 at aa 21-43, 58-77, 100-122, 132-154,
FT                   174-191, 201-220, 252-274, 302-324, 336-358, 373-395,
FT                   407-424, 428-450, 469-491 and 501-523"
FT   CDS             421271..422434
FT                   /transl_table=11
FT                   /locus_tag="SUB0427"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41089"
FT                   /db_xref="GOA:B9DTU6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU6"
FT                   /protein_id="CAR41089.1"
FT                   /translation="MIEYDFKKQPNRLHESSVKWRESENNPNLLQLWVADMDFQVMPEI
FT                   REALITHVSQDILGYTYPRQDLYQAIINWEMIEHGYGISKDCLLFIDGVVPALSIALQS
FT                   YTQEGDAVLINSPVYPPFARTIQANNRKVVRNELVISEGRYTIDFEQLEKQISEEQVKL
FT                   YFLCNPHNPGGRVWSQEELFKIGTLCQKYQVLLVSDEIHQDLALFGNKHHSFNTIRSDF
FT                   KDFSIILSSATKTFNIAGTKNSFAMIENPILRRLFKKTQIKNNQLEIPTVGLVATEAAY
FT                   TYGRDWLNQLKKTLEENITFVTDFLGEYTKIRVMKPEGTYLIWLDFTAYGLEQKDLMTK
FT                   LKEEAHLVLNDGETFGKSGKGYARFNAATPMSVIVKACQRLARVFPK"
FT   misc_feature    421505..422425
FT                   /locus_tag="SUB0427"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.2e-12"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS             422526..423155
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SUB0428"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41091"
FT                   /db_xref="GOA:B9DTU7"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTU7"
FT                   /protein_id="CAR41091.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRREDTSTKNFRELVNEIAMLMGYEVS
FT                   RDLPLEDVEIQTPVAKTIQKQLTGKKLAIVPILRAGIGMVDGFLSLVPAAKVGHIGMYR
FT                   DEETLEPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGAGNIKFVCLVAA
FT                   PEGVKKLQEAHPDVDIYTAALDEKLNEHGYIVPGLGDAGDRLFGTK"
FT   misc_feature    422664..423065
FT                   /gene="upp"
FT                   /locus_tag="SUB0428"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 2.1e-13"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS             423579..424169
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SUB0429"
FT                   /product="putative ATP-dependent Clp protease proteolytic
FT                   subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41093"
FT                   /db_xref="GOA:B9DTU8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTU8"
FT                   /protein_id="CAR41093.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKSDVQTIVMGMAASMGTIIASS
FT                   GTKGKRFMLPNAEYLIHQPMGGTGSGTQQTDMAIVAEQLLKTRKRLEKILSDNSGKTIK
FT                   QIHKDAERDYWMDAKETLEYGFIDAIMENNELK"
FT   misc_feature    423606..424157
FT                   /gene="clpP"
FT                   /locus_tag="SUB0429"
FT                   /note="HMMPfam hit to PF00574, Clp protease, score
FT                   3.4e-114"
FT                   /inference="protein motif:HMMPfam:PF00574"
FT   misc_feature    423840..423875
FT                   /note="PS00381 Endopeptidase Clp serine active site."
FT                   /inference="protein motif:Prosite:PS00381"
FT   CDS             424412..424858
FT                   /transl_table=11
FT                   /locus_tag="SUB0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41095"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTU9"
FT                   /protein_id="CAR41095.1"
FT                   /translation="MLVVNEELVKIDDAIDCLVDDLLKCKTFQTYLEKKSLFENDSVLQ
FT                   KDILTFKDLAEEYDKRKHLITFRPELLDLRKEVYAKKRALDLHPKVVDLRLAEVDFQEI
FT                   LAQVTQAIADTVSSHIFVDTGLPLSPKKERFSLGIYQNIKEKDS"
FT   misc_feature    424412..424828
FT                   /locus_tag="SUB0430"
FT                   /note="HMMPfam hit to PF07050, Protein of unknown function
FT                   (DUF1333), score 7e-26"
FT                   /inference="protein motif:HMMPfam:PF07050"
FT   CDS             424858..425115
FT                   /transl_table=11
FT                   /locus_tag="SUB0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41097"
FT                   /db_xref="GOA:B9DTV0"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTV0"
FT                   /protein_id="CAR41097.1"
FT                   /translation="MFEKQKRVGLVVYLYYNRDARKVHKYGDVYYHSKKGRYLVMYVNQ
FT                   NDLEEKMKELQKLKFVKEAVASAFDEIDHQFVGNLHREAN"
FT   CDS             425255..426427
FT                   /transl_table=11
FT                   /locus_tag="SUB0432"
FT                   /product="branched-chain amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41099"
FT                   /db_xref="GOA:B9DTV1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV1"
FT                   /protein_id="CAR41099.1"
FT                   /translation="MKKKLLVSTIACLSLLSLAACDAAPPSSTSNAKGTKIGKTIKLGL
FT                   NLELTGGVSAYGSAEKVGALMAVNEINRSGGVDGKKIEVISKDNKSENAESATVTTSLA
FT                   TQSNVNVIIGPATSGAAAAASPNATSAAVPLITPSGTQDDLTIAKDGKTYDYIYRTTFI
FT                   DSYQGDVLSKFATEQLKVKKVALFYDNSSDYAKGIAKRFKKVFKETIVSESTYQSGDTD
FT                   FQSALTKMKNQSFDAIIMPGYYQETGTIIKQAREMGISVPIVGPDGFADAKLVELAGQE
FT                   NVNNVYYLSGYSASTSEKASAFAQKYKKKYGEEPSMFVALAYDSVYMMADAAKGAKTSK
FT                   DISKALAQLKDFQGVTGTMSIDQKHNPIKSVTVIGLTKGKESSATVIKAE"
FT   sig_peptide     425255..425350
FT                   /locus_tag="SUB0432"
FT                   /note="Signal peptide predicted for SUB0432 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.976 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    425285..425317
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    425429..426394
FT                   /locus_tag="SUB0432"
FT                   /note="HMMPfam hit to PF01094, Receptor family ligand
FT                   binding region, score 7.6e-49"
FT                   /inference="protein motif:HMMPfam:PF01094"
FT   CDS             426468..427337
FT                   /transl_table=11
FT                   /locus_tag="SUB0433"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41101"
FT                   /db_xref="GOA:B9DTV2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV2"
FT                   /protein_id="CAR41101.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDLFMMGAF
FT                   IGFYLINVFHLNFFLALVLTMILTAILGMLIEFLAYRPLRHSTRIAALITAIGVSFLLE
FT                   YGMVYLVGAEARAFPQALKTVKYNLGPIAITNVQVIILTVSLLLMLGLQFIVKQTKMGK
FT                   AMRAVSVDSDAAQLMGINVNSTISFTFALGSALAGAAGVLIGLYYNSINPLMGMTPGIK
FT                   AFVAAVLGGIGIIPGAALGGFIIGLLETFSVSIGLSSYRDAIVYAVLIVILLIRPAGLF
FT                   GKNIKEKV"
FT   misc_feature    426477..427286
FT                   /locus_tag="SUB0433"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 4e-44"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   misc_feature    order(426486..426554,426582..426635,426639..426707,
FT                   426735..426803,426864..426932,427029..427097,
FT                   427134..427202,427245..427313)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0433 by TMHMM2.0 at aa 7-29, 39-56, 58-80, 90-112,
FT                   133-155, 188-210, 223-245 and 260-282"
FT   CDS             427340..428293
FT                   /transl_table=11
FT                   /locus_tag="SUB0434"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41102"
FT                   /db_xref="GOA:B9DTV3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV3"
FT                   /protein_id="CAR41102.1"
FT                   /translation="MKKNSKSIMAWFGIIALVYLLLSFLIGKDIIGPYYVQILMGIGIS
FT                   IIMAMGTNLVLGFSGQFPLGQAGFMAIGAYTTAIFTNSMPTYLGFYLSMVLGVLIAGLV
FT                   GVLVGFPTLRLKGDYLAIATLGVAEIIRIAIVNGGDLTNGAAGLTGVLRYTSWPVVYAF
FT                   VILIIILTMNFLRSSSGRQVISVREDEIAAESMGVNTTKMKVMTFAFAAMTASIAGSLY
FT                   VGYIGTVVPKDFTLMRSIDYLIIAVLGGLGSMTGTIVAAIVLGALNMYLQSFSDVRMII
FT                   YSLALILVMVFKPSGLLGTKECQLSHLFSKNDKEGN"
FT   sig_peptide     427340..427420
FT                   /locus_tag="SUB0434"
FT                   /note="Signal peptide predicted for SUB0434 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.648) with cleavage site
FT                   probability 0.474 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(427358..427417,427445..427513,427526..427579,
FT                   427607..427675,427694..427747,427805..427864,
FT                   427961..428029,428072..428140,428177..428236)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SUB0434 by TMHMM2.0 at aa 7-26, 36-58, 63-80, 90-112,
FT                   119-136, 156-175, 208-230, 245-267 and 280-299"
FT   misc_feature    427439..428209
FT                   /locus_tag="SUB0434"
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 1e-39"
FT                   /inference="protein motif:HMMPfam:PF02653"
FT   CDS             428293..429057
FT                   /transl_table=11
FT                   /locus_tag="SUB0435"
FT                   /product="branched-chain amino acid transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41103"
FT                   /db_xref="GOA:B9DTV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV4"
FT                   /protein_id="CAR41103.1"
FT                   /translation="MALLEVKNLSKHFGGLTAVGDVSMELHEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYVPSEGTITLDGTLLNKKTPYQIASLGLSRTFQNIRLFKDMTVLDNVLIGIA
FT                   NQEKPHLLSSLLRLPYYYRSEAELKEKALQLLAIFDLDGEANTLARNLPYGQQRRLEIV
FT                   RALATKPKILFLDEPAAGMNPQETAELTSLIRHIKDDFGITIILIEHDMSLVMEVTERI
FT                   YVLEYGRLIAHGKPDDIKKNKRVIEAYLGGEI"
FT   misc_feature    428377..428976
FT                   /locus_tag="SUB0435"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.1e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    428398..428421
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             429057..429767
FT                   /transl_table=11
FT                   /locus_tag="SUB0436"
FT                   /product="branched-chain amino acid transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41104"
FT                   /db_xref="GOA:B9DTV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV5"
FT                   /protein_id="CAR41104.1"
FT                   /translation="MAMLTVENLSINYGAIEAVKEVSFRVEEGEVVTLIGANGAGKTSI
FT                   LRTISGLVRPKSGRISFLGEDIHKSQARKIVAKGLSQVPEGRHVFAGLTVMENLEMGAF
FT                   LKKDKADNQKTLKMIFDRFPRLEERKHQDAATLSGGEQQMLAMGRALMSKPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQGMTVLLIEQNANKALSIADRAYVLETGKVVLSGKGSE
FT                   LLASDQVKKAYLGG"
FT   misc_feature    429141..429692
FT                   /locus_tag="SUB0436"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    429162..429185
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    429465..429509
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             429837..430499
FT                   /transl_table=11
FT                   /locus_tag="SUB0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41105"
FT                   /db_xref="GOA:B9DTV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV6"
FT                   /protein_id="CAR41105.1"
FT                   /translation="MSVKDYMTKDVIAISPETGVAKAADIMRDNDVRRLPVLEKGKLVG
FT                   LVTAGTMAEASPSKATSLSIYEMNYLLNKTKIRDIMIKKVITVSPNASLEDAIYLMLQH
FT                   KIGVLPVLDKDELCGIITDRDVFKAFLHVSGYGIEGTRLVLEADNVVGVLAKVADAISK
FT                   ENLNIRRTVVDSRPSGKTVIEIQIDGHGETLTLKENLEKIGVTVSSIEKTSEKESLL"
FT   misc_feature    429849..430007
FT                   /locus_tag="SUB0437"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 2.5e-15"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    430071..430229
FT                   /locus_tag="SUB0437"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 7.6e-19"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    430257..430472
FT                   /locus_tag="SUB0437"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 2.7e-06"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS             430583..431218
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SUB0438"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41106"
FT                   /db_xref="GOA:B9DTV7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTV7"
FT                   /protein_id="CAR41106.1"
FT                   /translation="MTKGKIITLEGPDGAGKTSVLEQLVLKLEKDNEQSIVTTREPGGV
FT                   AISESIRNIILDVNNTEMDFKTELLLYIAARRQHLVEKVLPSLSAGKLVFIDRFIDSSV
FT                   AYQGEGRGLNKSDIEWLNDFATDGIKPDLTLLFDVPSEIGIARINQNVNREINRLDLEK
FT                   LEMHQKVRQGYLELAKANPDRIVLIDASKPLDDVVDEAYRVIKERFAH"
FT   misc_feature    430607..431185
FT                   /gene="tmk"
FT                   /locus_tag="SUB0438"
FT                   /note="HMMPfam hit to PF02223, Thymidylate kinase, score
FT                   3.8e-55"
FT                   /inference="protein motif:HMMPfam:PF02223"
FT   misc_feature    430613..430636
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             431234..432109
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="SUB0439"
FT                   /product="putative DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41107"
FT                   /db_xref="GOA:B9DTV8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV8"
FT                   /protein_id="CAR41107.1"
FT                   /translation="MTIETQAPKAYSAFKQVLQEDRLNHAYLFSGDYANLEMAIFLAKS
FT                   CFCQEKTNGLPCQHCRTCQLIENNEFSDMTLLEPSGQVIKTETVKEMMKNFSRTGYESE
FT                   KQVFIIKDCEKMHVNAANSLLKYIEEPQSASYIFLLTNDDNLVLPTIKSRTQIFHFPKD
FT                   EAFLSLEAQKKGLLKSQADLLAKLAKNPEDLERLASENKVLDLMTLSQKFVSVLIKDKA
FT                   KAYLEVNRLNHVASEKSDQDTILKLLTFILANNYSQPNALHYLDALYQARLMWQSNVSF
FT                   QNSLEYMVLS"
FT   misc_feature    431369..431404
FT                   /note="PS00022 EGF-like domain signature 1."
FT                   /inference="protein motif:Prosite:PS00022"
FT   CDS             432106..432906
FT                   /transl_table=11
FT                   /locus_tag="SUB0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41108"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTV9"
FT                   /protein_id="CAR41108.1"
FT                   /translation="MTKTIGLHFPEFNAIKYVKTDKDFPLGTWLLVKDAKGSRLAQVKQ
FT                   GMKQLQQAQLPGDMPYVIGKASDMDMKAYRANLAYAEASKADVKALIKQNQLSMKVIDI
FT                   IFPLDRSYVLITFSAEERVDFRQLLKDLAALFKTRIELRQLNNREEAKVYGGIGPCGRP
FT                   ICCSTFLGEFPAVSIKMLKNQDLSLNSGKSLGYCGRFLCCLQYEDAFYSDRKKRFPDYG
FT                   TLVETKEGKGRVVSVNIFEETVKVAFEDKQSCMTYILEEIKIGQ"
FT   misc_feature    432277..432540
FT                   /locus_tag="SUB0440"
FT                   /note="HMMPfam hit to PF04468, PSP1 C-terminal conserved
FT                   region, score 2.5e-25"
FT                   /inference="protein motif:HMMPfam:PF04468"
FT   CDS             432896..433249
FT                   /transl_table=11
FT                   /locus_tag="SUB0441"
FT                   /product="initiation-control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41109"
FT                   /db_xref="GOA:B9DTW0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW0"
FT                   /protein_id="CAR41109.1"
FT                   /translation="MVNKRELFDAFEGFSQNLMVTLADVEALKKQVQGLVEENTVLRLE
FT                   NSKLRERLSQMEHETSPKPSSRNTNDHLEGIYDEGFHICNSYYGQTRENSEECLFCTEL
FT                   LDRKMHHEDSKKF"
FT   misc_feature    432899..433216
FT                   /locus_tag="SUB0441"
FT                   /note="HMMPfam hit to PF06156, Protein of unknown function
FT                   (DUF972), score 4.2e-55"
FT                   /inference="protein motif:HMMPfam:PF06156"
FT   CDS             433227..434090
FT                   /transl_table=11
FT                   /locus_tag="SUB0442"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41110"
FT                   /db_xref="GOA:B9DTW1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW1"
FT                   /protein_id="CAR41110.1"
FT                   /translation="MKIQKSFKKDQIFGTLYLVPTPIGNLQDMTFRAVSTLKEVDYICA
FT                   EDTRNTGILLKHFGIETRQLSFHEHNAFDKIPQLIAYLKEGKSLAQVSDAGMPSISDPG
FT                   HDLVKAAIAEDISVVALPGASAGITALIASGLVPQPHIFYGFLPRKVGQKLEFLQDKKN
FT                   YPETQIFYESPHRVSDTLRHIKDVYGDRQVVLVRELTKYYEEYQRGTISELIEAIDQAP
FT                   LKGECLLIVEGYLADKQVVLEDLDLFSLVKAEVEQGLKPNQAIKKVAKTYHINRQEVYN
FT                   AYHGLD"
FT   misc_feature    433269..433871
FT                   /locus_tag="SUB0442"
FT                   /note="HMMPfam hit to PF00590, Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylas, score 7.8e-33"
FT                   /inference="protein motif:HMMPfam:PF00590"
FT   misc_feature    433467..433490
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    433503..433538
FT                   /note="PS01296 Uncharacterized protein family UPF0011
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01296"
FT   CDS             434216..434611
FT                   /transl_table=11
FT                   /locus_tag="SUB0443"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41111"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW2"
FT                   /protein_id="CAR41111.1"
FT                   /translation="MTEDELMGLVILSVYGIILIIIAISALLTVIGNWRLFEKAGQNGW
FT                   YAIIPFYGGFIKHKITFGEANKWLYFISWVFAIYYAYTHFCYVRAFGGSKGLAVLSLFF
FT                   PGITTLILAFGKLYHEKNYHVVPHIIN"
FT   misc_feature    order(434243..434311,434420..434488,434501..434569)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0443 by TMHMM2.0 at aa 10-32, 69-91 and 96-118"
FT   CDS             complement(434645..435277)
FT                   /transl_table=11
FT                   /locus_tag="SUB0444"
FT                   /product="CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41112"
FT                   /db_xref="GOA:B9DTW3"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW3"
FT                   /protein_id="CAR41112.1"
FT                   /translation="MLIKEFCAENLTNLSQLNSQQINRVELCDNLAVGGTTPSFGVIKE
FT                   ACDLLHEKSITVATMIRPRGGDFVYNDLELRAMEEDILKAVEAGSDALVMGLLTKDNQI
FT                   DCDAIEQLLPATQGLPLVFHMAFDHIPEKDQKTAIDTLVDYGFIRILLHGSTEANDIFE
FT                   NLDHIRDLIQYANGKIEIMLGGGVTSQNALRLSQESGSIILHGTKIV"
FT   misc_feature    complement(434648..435274)
FT                   /locus_tag="SUB0444"
FT                   /note="HMMPfam hit to PF03932, CutC family, score 1e-106"
FT                   /inference="protein motif:HMMPfam:PF03932"
FT   CDS             435401..436495
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="SUB0445"
FT                   /product="putative phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41114"
FT                   /db_xref="GOA:B9DTW4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003248"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTW4"
FT                   /protein_id="CAR41114.1"
FT                   /translation="MTIYNFSAGPAVLPKPVLEKAQAEMLDYRSSGMSVLEMSHRSKEF
FT                   DAIIKDAEYLLRELMAIPDHYRVLFLQGGASTQFSMIPLNLAKGKKAYYHVAGSWGKKA
FT                   YTEAVKLSKTIPFEPILLASSEEETFSYVPTFDKDVIDPDAAYVHLTTNNTIEGTALYD
FT                   IPDTNGVPIVADMSSNILAVRYKVNDFGMIYAGAQKNIGPAGVTVVIIRNDLLNSEPAL
FT                   SSMLDYKIQADAQSLYNTPPAYSIYIAKMVFEWVKSLGGLDQMEVKNREKSGLLYSFIE
FT                   QSSFYQSPVKNPKDRSVANIPFTTPSKDLDEKFVKEAEAAGFKNIKGHRSVGGMRASLY
FT                   NAFPVEGVIALIDFMRVFENQNSQ"
FT   misc_feature    435434..436453
FT                   /gene="serC"
FT                   /locus_tag="SUB0445"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 4.4e-45"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   misc_feature    435968..436027
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00595"
FT   CDS             436511..437059
FT                   /transl_table=11
FT                   /locus_tag="SUB0446"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41115"
FT                   /db_xref="GOA:B9DTW5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW5"
FT                   /protein_id="CAR41115.1"
FT                   /translation="MEIRLAFPNEIQDILVLIEGAKEVIASYGSDQWQDGYPNEEVIIN
FT                   DILSGQGYVALVDHHIVAYAAAIYGNEEAYNHIYDGQWLVDNQDYLTFHRIAVSKDMQG
FT                   QALAQTFIQGLIEGFDFKDFRCDTHEKNLAMQHILQKLGYHYCGKVPLAGMRLAYQKIK
FT                   EDHERADYQEIDEDSRYGI"
FT   misc_feature    436667..436945
FT                   /locus_tag="SUB0446"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 5.6e-06"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS             437117..438292
FT                   /transl_table=11
FT                   /locus_tag="SUB0447"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41117"
FT                   /db_xref="GOA:B9DTW6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW6"
FT                   /protein_id="CAR41117.1"
FT                   /translation="MVYSVKTFNNINQIGLKELGNAFQIDGDLSENPDAYILRSQNLHG
FT                   HQFPEKLKAIARAGAGTNNIPIEDATASGIVVFNTPGANANAVKEAVIAAILLSARDYL
FT                   AANKWVNTLTGDDVPKQIEAGKKQFAGSEISGKTLGVIGLGAIGARIANDAYRLGMNVL
FT                   GYDPYVSIETAWNISSHVKRVNDIKEIFASSDYITVHVPLTEDTRHTFNKEAFQLMKKG
FT                   TSIINFARAELVDELALNDAIETGAVKNYVTDFGHQGLLNQDKITVFPHVGGSTEEAEL
FT                   NCAIMASQTIRRFLETGEITNAVNFPNVHQALSAPYRITLINKNVPNIVAKISTAVSDL
FT                   DINIDNIINRSKGDYAYTLLDLDECDRGKIDQLVEEFEKSDNIVRVRLITK"
FT   misc_feature    437129..437362
FT                   /locus_tag="SUB0447"
FT                   /note="HMMPfam hit to PF00389, D-isomer specific
FT                   2-hydroxyacid dehydrog, score 0.00071"
FT                   /inference="protein motif:HMMPfam:PF00389"
FT   misc_feature    437378..437929
FT                   /locus_tag="SUB0447"
FT                   /note="HMMPfam hit to PF02826, D-isomer specific
FT                   2-hydroxyacid dehydrog, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF02826"
FT   misc_feature    437507..437530
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    437531..437614
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT                   /inference="protein motif:Prosite:PS00065"
FT   misc_feature    438065..438283
FT                   /locus_tag="SUB0447"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 2.3e-05"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS             438341..438817
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="SUB0448"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41119"
FT                   /db_xref="GOA:B9DTW7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW7"
FT                   /protein_id="CAR41119.1"
FT                   /translation="MTLYKTIYQSPLGPISLIADESALIGAWFFNQKYFEDGIKQVPLE
FT                   GVNAPLAAACQWLDAYFKQEKPAAADFIALKGTDFRQRVWTYLQTIPHGETRTYGQIAK
FT                   ALNCQSAQAVGGAVGHNPLSIFVPCHRVLGSQGQLTGYAGGLDKKIWLLEKEKG"
FT   misc_feature    438569..438814
FT                   /gene="ogt"
FT                   /locus_tag="SUB0448"
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferas, score 4e-38"
FT                   /inference="protein motif:HMMPfam:PF01035"
FT   misc_feature    438719..438739
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS             438820..439173
FT                   /transl_table=11
FT                   /locus_tag="SUB0449"
FT                   /product="ArsC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41120"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW8"
FT                   /protein_id="CAR41120.1"
FT                   /translation="MYTFYEYPKCSTCRKAKADLKQYISDFESVDIKTTPPKAELLKEW
FT                   METSDFTLKNFFNTSGNSYKEMGLKDKIDDLSIEEAAQLLSQDGMLIKRPILVKDKQVI
FT                   QIGARKPYGELFK"
FT   misc_feature    438832..439170
FT                   /locus_tag="SUB0449"
FT                   /note="HMMPfam hit to PF03960, ArsC family, score 2.7e-36"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS             complement(439206..440108)
FT                   /transl_table=11
FT                   /locus_tag="SUB0450"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41121"
FT                   /db_xref="GOA:B9DTW9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTW9"
FT                   /protein_id="CAR41121.1"
FT                   /translation="MNYKNIEKKALLISSIVNGINAFAGIFIYIITGLNALLLDSVFSV
FT                   IGLVSSIAAIYISKNSHKKTDNFPRGLYFLEPLFGVLKSIATLMLLLIALLESGAVAYS
FT                   YFTYGEGELIHTGPVLPYTILTGMLCFALSYYNYRKNKAINNLSTILHAESKANLVDGL
FT                   ISIGIGITVFLLNFISQDGHLGFFHYTGDFFITVILVLLSFKEPLTILIHSFKEFAYST
FT                   VQNEKLEEAIVYIVNHHLKEHQDDYDIFVHKQGMQINVRILILDLESHHIITQFALKKA
FT                   DLLNHLRKKFDQIHLEFVF"
FT   misc_feature    complement(439209..440078)
FT                   /locus_tag="SUB0450"
FT                   /note="HMMPfam hit to PF01545, Cation efflux family, score
FT                   2.7e-05"
FT                   /inference="protein motif:HMMPfam:PF01545"
FT   misc_feature    complement(order(439464..439532,439575..439643,
FT                   439704..439772,439830..439898,439935..440003,
FT                   440016..440075))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0450 by TMHMM2.0 at aa 12-31, 36-58, 71-93, 113-135,
FT                   156-178 and 193-215"
FT   CDS             complement(440506..440922)
FT                   /transl_table=11
FT                   /locus_tag="SUB0451"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41123"
FT                   /db_xref="GOA:B9DTX0"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX0"
FT                   /protein_id="CAR41123.1"
FT                   /translation="MVTALNVYLVTNGNGKEAVEFYKDAFNAEITNLMFWKDGVPDCPK
FT                   DREDLVMNAQMEFNGIRLQLSDENPDFEYKVGGNMSAALIVDSIEEAQELYAKLTVNAQ
FT                   EIVMELQEMFWSPAYANFIDQFGIMWQINTELSN"
FT   misc_feature    complement(440527..440913)
FT                   /locus_tag="SUB0451"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 0.00015"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS             complement(440944..441318)
FT                   /transl_table=11
FT                   /locus_tag="SUB0452"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41124"
FT                   /db_xref="GOA:B9DTX1"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX1"
FT                   /protein_id="CAR41124.1"
FT                   /translation="MISKSTTMLYVNDTEAAMTFWTEKMGFVITDQADSEGFKSFEVAP
FT                   SLDSATKFGIHNKDMVAQANPGMNVDFPSLLFEADDLEAEYKTLTENGVATNPIMEYQG
FT                   MVHFTFQDNEGNYIAVRQTI"
FT   misc_feature    complement(440959..441312)
FT                   /locus_tag="SUB0452"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 2.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS             complement(441458..442120)
FT                   /transl_table=11
FT                   /locus_tag="SUB0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41126"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX2"
FT                   /protein_id="CAR41126.1"
FT                   /translation="MTSQEKFDLLEQRMTSQADAGQAEKMAAYMKNHFDFYGIPAGPRR
FT                   LIYKDIIAADKKTKSIDWNLLDLAWASPKREMHYFVCDYLKALGKWLSFQDVPTILGFA
FT                   KSNQWWDTIDHFDHILGSIEDDRRDAFMLELSLSEDFWLRRIAIDHQLGKKDKTKPELL
FT                   AAIILNNLGSSEFFINKAIGWALRDYSKINPDWVKNFIATYRDKLAPLSIREASKYL"
FT   CDS             complement(442122..442949)
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="SUB0454"
FT                   /product="exodeoxyribonuclease"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41130"
FT                   /db_xref="GOA:B9DTX3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX3"
FT                   /protein_id="CAR41130.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVTEDPDILAIQET
FT                   KLSATGPTKKHMEILLSYFPNHLHVWRSSVEPARKGYAGTLFLYRNTLNPVVTFPEIGA
FT                   PDPMDAEGRIITLEFDDFYVTQVYTPNAGDQLRRLPERQEWDIKYAEYLASLDRNKPVL
FT                   ATGDYNVAHHEIDLANPASNRRSAGFTDEERAGFTALLAKGFTDTFRYLHGDIPNVYTW
FT                   WAQRSKTSKINNTGWRIDYWLTSNRIADKVIKSEMIHSGERQDHTPILLEIDL"
FT   misc_feature    complement(442131..442949)
FT                   /gene="exoA"
FT                   /locus_tag="SUB0454"
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase fa, score 1.3e-41"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   misc_feature    complement(442215..442250)
FT                   /note="PS00728 AP endonucleases family 1 signature 3."
FT                   /inference="protein motif:Prosite:PS00728"
FT   misc_feature    complement(442812..442841)
FT                   /note="PS00726 AP endonucleases family 1 signature 1."
FT                   /inference="protein motif:Prosite:PS00726"
FT   CDS             443126..443407
FT                   /transl_table=11
FT                   /locus_tag="SUB0455"
FT                   /product="ArsR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41132"
FT                   /db_xref="GOA:B9DRC4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC4"
FT                   /protein_id="CAR41132.1"
FT                   /translation="MSFAQTFKALSDPIRRDILTLLKDGQMSAGDIANQFDLAQASISY
FT                   HLMILKKADLIQETKVKNFIYYDINTSVLEDIMIWLKEIKGDSKYENE"
FT   misc_feature    443144..443377
FT                   /locus_tag="SUB0455"
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 1e-21"
FT                   /inference="protein motif:HMMPfam:PF01022"
FT   misc_feature    443204..443269
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1247.000, SD 3.43 at aa 27-48, sequence
FT                   MSAGDIANQFDLAQASISYHLM"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             443394..444023
FT                   /transl_table=11
FT                   /locus_tag="SUB0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41134"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC5"
FT                   /protein_id="CAR41134.1"
FT                   /translation="MKMNKKLLVLTSFIVLIPIFIGLALWNQIPDQVPTHFDFSGNPDD
FT                   YSSKFQAVFFLPFFLLILHLFCLWITTKDPKSGRLGKVQYLVYWIVPIISIFVQSMVIL
FT                   SSIHKGFQFNANLFMGFLFLILGNYLPKIRQNYTVGIKIPWTLNNEMNWNKTHRLAGKI
FT                   WVTGGILFLLMGMLGITNPFPVFGLLIILILIPMAYSYCLYKYKQL"
FT   sig_peptide     443394..443498
FT                   /locus_tag="SUB0456"
FT                   /note="Signal peptide predicted for SUB0456 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.648) with cleavage site
FT                   probability 0.470 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(443412..443471,443541..443609,443646..443714,
FT                   443724..443783,443865..443933,443946..444005)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0456 by TMHMM2.0 at aa 7-26, 50-72, 85-107, 111-130,
FT                   158-180 and 185-204"
FT   misc_feature    443430..443567
FT                   /locus_tag="SUB0456"
FT                   /note="HMMPfam hit to PF07853, Protein of unknown function
FT                   (DUF1648), score 2.9e-17"
FT                   /inference="protein motif:HMMPfam:PF07853"
FT   CDS             444121..445788
FT                   /transl_table=11
FT                   /locus_tag="SUB0457"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41136"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC6"
FT                   /protein_id="CAR41136.1"
FT                   /translation="MKKRVQLLAAVVSFFVLVNYYWMHLPPINLLSGDFWLFMILILFL
FT                   IAINLIIASASNGLKLLFGKKSKVKKVKDVTQYVSLFSGPIRWIFLTILAISLGLGMIS
FT                   FFNGKMFRAKSYANVIKVKNADFKQDFPESNLSTLALLDRESAEKIGDTYLGTIDKVSQ
FT                   FGISKDYRQITIGKQPFRVSPLEYKSFWKWLTNRQVGINYYVKVNQTTGKAELVKLKEA
FT                   MKYSDSEYLFRDTKRHLRFLHPFTIFGEPSFEVDDQGNPYYVATTYAPKFGLSSLDPNG
FT                   AILLNAVTGKTKYYHLKDIPKWVDRVYSAENVLSRVNDHYTYQKGYWNTVFSQTGVKQT
FT                   TDSYNYITIGSNIYLYTGITSATADASNLGFILVNMRTREVTNYQLASATEKSAMTSAE
FT                   GEVQEKGYSATAPTLVKLNGKAYYLVSLKDGGSLVKSYALVDAEDYQQVTVNNDIETLI
FT                   SQFTDRDTSGLSLNSSTGKKAKIVSGQVDHLASQIISGTTVYYILSGNDIYKVRASKDT
FT                   PDELPFLKIGDHFKAELGEANYLQNLKINDEAEEVKSQ"
FT   misc_feature    order(444139..444195,444223..444291,444352..444420)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0457 by TMHMM2.0 at aa 7-25, 35-57 and 78-100"
FT   tRNA            445891..445979
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /note="tRNA Ser anticodon TGA, Cove score 50.21"
FT   CDS             446038..446757
FT                   /transl_table=11
FT                   /locus_tag="SUB0458"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41138"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC7"
FT                   /protein_id="CAR41138.1"
FT                   /translation="MSKRKKQKYFVHEALRCAISLTFISGYVNAFTFMTQGQRFAGIQS
FT                   GNVASLAMSLAQGDYRRALDFLLPIVAFMLGQSFTYFMHRWANKHKIHWYLFSSFVLTA
FT                   IAFLTSLLTPMLSSFYTVFGLAFFASIQVDTFKSLRGATYANVMMTGNVKNAAYQLTKG
FT                   LYEKNKEIITIGRNTALVIITFIFGAMLSTLLSLKYGEYSLGFVLLPLAYVNYLLGKEY
FT                   YHIQTKIKPFMTDYSEE"
FT   misc_feature    order(446074..446142,446224..446283,446317..446385,
FT                   446395..446454,446569..446628,446641..446694)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0458 by TMHMM2.0 at aa 13-35, 63-82, 94-116, 120-139,
FT                   178-197 and 202-219"
FT   misc_feature    446080..446694
FT                   /locus_tag="SUB0458"
FT                   /note="HMMPfam hit to PF06912, Protein of unknown function
FT                   (DUF1275), score 4.9e-70"
FT                   /inference="protein motif:HMMPfam:PF06912"
FT   CDS             446856..448862
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /gene_synonym="metS"
FT                   /locus_tag="SUB0459"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41140"
FT                   /db_xref="GOA:B9DRC8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC8"
FT                   /protein_id="CAR41140.1"
FT                   /translation="MTDKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNHQV
FT                   FYLTGLDEHGQKIQTKAEEAGITPQEYVDGMAKGVKELWELLDISYDKFIRTTDDYHEE
FT                   VVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGNVIGGIAPSGHEV
FT                   EWVSEESYFLRLGKYADKLVAFFNEHPEFIQPEGRMNEMIKNFIEPGLEDLAVSRTTFT
FT                   WGVKVPSNPKHVVYVWIDALLNYATALGYGQEDKANFETFWNNGTVFHMVGKDILRFHS
FT                   IYWPILLMMLDMKLPERLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMR
FT                   SLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFGGKIPAYTENVTAFDGE
FT                   LQDLVTEKITDYHKQMETVDYPRALDAIWAIISRANKYIDETAPWVLAKEDGDKEQLAS
FT                   VMAHLAASLRVVAHLIQPFMMTTSNAIMEQLGLGQSFDLENLSLAGMPSDITVISKGQP
FT                   IFPRLDMEEEIAYIKEQMEGGSAIPQEKEWIPEEVDLKSEKEEIKFETFDACEIRVAEV
FT                   KEVSKVEGSDKLLRFRLDAGDGEDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMK
FT                   KYVSQGMILSAEHDGKLTVLTVDPAVPNGSIIG"
FT   misc_feature    446859..447908
FT                   /gene="metG"
FT                   /gene_synonym="metS"
FT                   /locus_tag="SUB0459"
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 3.2e-08"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    448566..448853
FT                   /gene="metG"
FT                   /gene_synonym="metS"
FT                   /locus_tag="SUB0459"
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 2.2e-32"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS             448960..449286
FT                   /transl_table=11
FT                   /locus_tag="SUB0460"
FT                   /product="putative membrane protein"
FT                   /note="Possible gene remnant. Weakly similar to
FT                   Photorhabdus luminescens (subsp. laumondii) ribose
FT                   transport system permease protein RbsC UniProt:Q7NA78_PHOLL
FT                   (EMBL:BX571859) (323 aa) fasta scores: E()=3.8, 30.928% id
FT                   in 97 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41143"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRC9"
FT                   /protein_id="CAR41143.1"
FT                   /translation="MRFFQKLQLLKSKNSQLTLDILTNIVVYVMVVLFYLSGITLILMI
FT                   TSHDTIINLPIIKDRFYGLASIVLVRQVPSLVLGFALLICGRAIANRNARAFYPTLVFL
FT                   ILIT"
FT   misc_feature    order(449020..449088,449146..449214)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0460 by TMHMM2.0 at aa 21-43 and 63-85"
FT   CDS             449259..449678
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0461"
FT                   /product="putative membrane protein (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Lactobacillus plantarum integral membrane protein
FT                   UniProt:Q88YQ7_LACPL (EMBL:AL935253) (852 aa) fasta scores:
FT                   E()=8.4e-21, 42.553% id in 141 aa"
FT   misc_feature    449421..449675
FT                   /locus_tag="SUB0461"
FT                   /note="HMMPfam hit to PF04331, Family of unknown function
FT                   (DUF472), score 2.7e-07"
FT                   /inference="protein motif:HMMPfam:PF04331"
FT   CDS             449931..451274
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SUB0462"
FT                   /product="putative branched-chain amino acid transport
FT                   system carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41147"
FT                   /db_xref="GOA:B9DRD0"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD0"
FT                   /protein_id="CAR41147.1"
FT                   /translation="MVKKGFLTGLLLFGIFFGAGNLIFPPALGVASGTNFWPAIIGFCL
FT                   SGVGLAIMTLLVGTLTNGGFKQEMDIKFSPWFSLSFLVVLYLTIGPLFAIPRTATVSFE
FT                   VGLSPLVGNSQLALMIFSLCFFLAAFALAYNPNKIMTSVGKILTPLFALLILLLVVVGA
FT                   FKYGHADSGKASAEYVASAFGGGILAGYNTLDALASVAFCLVATETLKQFGFSSKKEYL
FT                   STIWVVGIVTSLAFSILYLGLAFLGNKFPIPSAVLADPSINKGAYVLAQASYQLFGSFG
FT                   RLFLSVMVVLTCFTTTVGLIVAVSEFFAKHFKALSYKVYTILFTLVGFFIANLGLNTVI
FT                   AFSVPVLTLLYPIVIVLVIIILLNKAFALSKKGMSLTIALVTVTSFFEVFAGLLPKTAI
FT                   ASLVAHIPFHAMSMGWVLPTLIGLAIAFVLPDKVKGEAFDLSQFENQA"
FT   misc_feature    449931..451229
FT                   /gene="brnQ"
FT                   /locus_tag="SUB0462"
FT                   /note="HMMPfam hit to PF05525, Branched-chain amino acid
FT                   transport p, score 1.3e-159"
FT                   /inference="protein motif:HMMPfam:PF05525"
FT   sig_peptide     449931..450026
FT                   /gene="brnQ"
FT                   /locus_tag="SUB0462"
FT                   /note="Signal peptide predicted for SUB0462 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.496 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(449949..450017,450045..450113,450147..450215,
FT                   450273..450332,450366..450434,450477..450545,
FT                   450603..450671,450777..450845,450870..450938,
FT                   450951..451019,451056..451109,451152..451220)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SUB0462 by TMHMM2.0 at aa 7-29, 39-61, 73-95, 115-134,
FT                   146-168, 183-205, 225-247, 283-305, 314-336, 341-363,
FT                   376-393 and 408-430"
FT   CDS             complement(451382..451714)
FT                   /transl_table=11
FT                   /locus_tag="SUB0463"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41149"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD1"
FT                   /protein_id="CAR41149.1"
FT                   /translation="MSIFLKIAALVVFLVITWLIVHLSSKGNRVAGQIRGHNYHITFKN
FT                   YPTIDLRENKSMMQNISIISHPSDNSYSVTSHLNGKELKEMLKNQYQLSDSDLIVDTLA
FT                   YRFPTQ"
FT   sig_peptide     complement(451634..451714)
FT                   /locus_tag="SUB0463"
FT                   /note="Signal peptide predicted for SUB0463 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.824) with cleavage site
FT                   probability 0.447 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(451643..451711)
FT                   /note="1 probable transmembrane helix predicted for SUB0463
FT                   by TMHMM2.0 at aa 2-24"
FT   CDS             451911..452147
FT                   /transl_table=11
FT                   /locus_tag="SUB0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="Possible alternative upstream translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41150"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD2"
FT                   /protein_id="CAR41150.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDSIEQNGQALEVTP
FT                   YFLINVSGEGEGFSMWSPTPCDVLAEDWVEVHD"
FT   CDS             452140..452838
FT                   /transl_table=11
FT                   /locus_tag="SUB0465"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41151"
FT                   /db_xref="GOA:B9DRD3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD3"
FT                   /protein_id="CAR41151.1"
FT                   /translation="MTKKVLVTGVSSGIGRAQAEHLLAKGYQVYGLDISLKPELKGDFH
FT                   FMRLDLSEDLSPLFDWLPQVDILLNTAGILDAYKPLLEMRQTDFEKLFATNFFSVVKLT
FT                   RFYLEKMLAQQSGIIINMCSIASFQAGGGGAAYTSSKHALAGFTRQLALDYAKAGIQVF
FT                   GIAPGAVQTGMTASDFIEGGLADWVAEQTPIGRWTQAEEIADLTDFLVSGKAASMQGEI
FT                   VKIDGGWTLK"
FT   sig_peptide     452140..452196
FT                   /locus_tag="SUB0465"
FT                   /note="Signal peptide predicted for SUB0465 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.830) with cleavage site
FT                   probability 0.812 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    452152..452826
FT                   /locus_tag="SUB0465"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.1e-59"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    452509..452595
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS             452935..453897
FT                   /transl_table=11
FT                   /locus_tag="SUB0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41156"
FT                   /db_xref="GOA:B9DRD4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD4"
FT                   /protein_id="CAR41156.1"
FT                   /translation="MKLTVVGTGKIVEEALPIITATNGIQVQALVSTPRSQEKAKALAD
FT                   HYQIQDLYTDLEEALTNPNTDTVYVATPNHLHYEMTKAALLAGKHVICEKPFTLKEAQA
FT                   QELAEIAKRKQLILLEAITNLYLENFAVLKEELANLGDIKIVDCNYSQYSSRYDAFKEG
FT                   VIAPAFDPEKGGGALRDLNIYNIHLVVALFGLPKTVNYLSNMERGVDTSGILLMDYLDF
FT                   KVVCIAAKDCSAEVRTTIQGNRGSLIVAGESNTLPQVQVTENGIEPRVINKNGSEHRMA
FT                   AEFRVFQAIIDERDFERAQEALDHSLKVMKVLDLASQGL"
FT   misc_feature    452935..453300
FT                   /locus_tag="SUB0466"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Rossm, score 1.5e-37"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   CDS             454028..455404
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /gene_synonym="tms"
FT                   /gene_synonym="glmU"
FT                   /locus_tag="SUB0468"
FT                   /product="bifunctional GlmU protein [includes:
FT                   UDP-N-acetylglucosamine pyrophosphorylase;
FT                   glucosamine-1-phosphate N-acetyltransferase]"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41160"
FT                   /db_xref="GOA:B9DRD5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRD5"
FT                   /protein_id="CAR41160.1"
FT                   /translation="MTNYAIILAAGKGTRMKSDLPKVLHQVSGLTMLEHVFRSVAHITP
FT                   QMNVTVIGHKAELVQEVLKEKSEFVLQTEQLGTGHAVMMAEEKLADLEGNTLVIAGDTP
FT                   LITGESLKNLIDFHVNHKNVATILTAKAEDPFGYGRIIRNHDDEVVKIVEQKDANEYEQ
FT                   KVKEINTGTYVFDNKRLFEALKNINTNNAQGEYYLTDVISIFRENKEKVGAYVLRDFNE
FT                   SLGVNDRVALATAESVMRRRINKAHMINGVTFQNPDATYIEADVSIAADVMIEANVSLK
FT                   GNSCIGAKSVLTNGTCIVDAQIGESVVITNSTIEESSIADGVTVGPYAHIRPGSQLDKN
FT                   VHIGNFVEVKGSHIGENTKAGHLTYIGNAVVGSDVNFGAGTITVNYDGKNKYKTVIGNN
FT                   VFVGSNSTLIAPLEIGDNALTAAGSTITKNVEPDSIAIGRSRQVIKEGYAKRLPHYPQK
FT                   "
FT   misc_feature    454037..454714
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
FT                   score 2e-11"
FT                   /inference="protein motif:HMMPfam:PF00483"
FT   misc_feature    454820..454873
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 7.6"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    454874..454927
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 70"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    454973..455026
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 3.5"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    455027..455080
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 11"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    455129..455182
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 64"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    455204..455257
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 0.73"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    455258..455311
FT                   /gene="gcaD"
FT                   /gene_synonym="glmU"
FT                   /gene_synonym="tms"
FT                   /locus_tag="SUB0468"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 36"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS             455425..455982
FT                   /transl_table=11
FT                   /locus_tag="SUB0469"
FT                   /product="putative ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41162"
FT                   /db_xref="GOA:B9DRD6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD6"
FT                   /protein_id="CAR41162.1"
FT                   /translation="MDFEEVTLKRKDIYKGTIFDVVVDDVQLPNNLGTSKRELVLHRGA
FT                   VSILAVTPENKLVIVKQYRKAIEGVSFEIPAGKLEMGENGSELEAAKRELEEETGYSGD
FT                   LELIYEFYTAIGFCNEKIKLYLATQLKKVENPRPQDDDEVLEIYELSYQECLDLIETGE
FT                   ICDAKTIIAIQYFGQQYGGDLG"
FT   misc_feature    455548..455952
FT                   /locus_tag="SUB0469"
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 7.3e-18"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   CDS             455979..456239
FT                   /transl_table=11
FT                   /locus_tag="SUB0470"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41163"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD7"
FT                   /protein_id="CAR41163.1"
FT                   /translation="MRKALLTDDIIEKAKRGDVIEDDFDVDSETKIMTFSDDLDDSHSN
FT                   RIYKSRRIENAKRNQFQSKLNLLLIALVLLIALLIYAVFNL"
FT   misc_feature    456171..456230
FT                   /note="1 probable transmembrane helix predicted for SUB0470
FT                   by TMHMM2.0 at aa 65-84"
FT   CDS             456255..456947
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /gene_synonym="mtn"
FT                   /gene_synonym="pfs"
FT                   /locus_tag="SUB0471"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41164"
FT                   /db_xref="GOA:B9DRD8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD8"
FT                   /protein_id="CAR41164.1"
FT                   /translation="MKIGIIAAMEEELRHLVDQLEDRHEEIVMSNRYHLGKIAGHDLVL
FT                   VQSGVGKVMSALTVAILVETFKVDALINTGSAGAVASHLQIGDVVVADRLVYHDVDLTA
FT                   FGYDYGQMSMQPLYFQADTNFVETFEEVLKKEKSRHAIGLIATGDSFVAGQDKIDAIKN
FT                   HFSDVLAVEMEGAAIAQAALATGKPFIVVRAMSDTAAHDANITFDQFIQEAGQKSAETL
FT                   IRFLEQLT"
FT   misc_feature    456258..456932
FT                   /gene="mtnN"
FT                   /gene_synonym="mtn"
FT                   /gene_synonym="pfs"
FT                   /locus_tag="SUB0471"
FT                   /note="HMMPfam hit to PF01048, Phosphorylase family, score
FT                   1.8e-59"
FT                   /inference="protein motif:HMMPfam:PF01048"
FT   CDS             complement(456981..457628)
FT                   /transl_table=11
FT                   /gene="scaR"
FT                   /gene_synonym="sloR"
FT                   /locus_tag="SUB0472"
FT                   /product="metal-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41166"
FT                   /db_xref="GOA:B9DRD9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRD9"
FT                   /protein_id="CAR41166.1"
FT                   /translation="MTPNKEDYLKCIYEIGQEKKKISNKQIAEKMQVSPPAVSEMIKKM
FT                   IAQDWIVKDSQKGYFLTEKGVDLVANLYRKHRLIEVFLIHQLGYSSQEVHQEAEILEHT
FT                   VSETFIDRLDQMLGFPEFCPHGGTIPRKGQALKEINHLTLYQMEKCGGYRLTRVQDQFD
FT                   LLNYLEQHQFTLNTLFQLEQIDNYAKTYTISFDDKQLIIPEHIAKQLFVSPQ"
FT   misc_feature    complement(456987..457205)
FT                   /gene="scaR"
FT                   /gene_synonym="sloR"
FT                   /locus_tag="SUB0472"
FT                   /note="HMMPfam hit to PF04023, FeoA domain, score 2.6e-06"
FT                   /inference="protein motif:HMMPfam:PF04023"
FT   misc_feature    complement(457233..457445)
FT                   /gene="scaR"
FT                   /gene_synonym="sloR"
FT                   /locus_tag="SUB0472"
FT                   /note="HMMPfam hit to PF02742, Iron dependent repressor,
FT                   metal bindin, score 4.1e-25"
FT                   /inference="protein motif:HMMPfam:PF02742"
FT   misc_feature    complement(457449..457628)
FT                   /gene="scaR"
FT                   /gene_synonym="sloR"
FT                   /locus_tag="SUB0472"
FT                   /note="HMMPfam hit to PF01325, Iron dependent repressor,
FT                   N-terminal D, score 6.2e-12"
FT                   /inference="protein motif:HMMPfam:PF01325"
FT   misc_feature    complement(457500..457565)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1646.000, SD 4.79 at aa 22-43, sequence
FT                   ISNKQIAEKMQVSPPAVSEMIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS             457774..458706
FT                   /transl_table=11
FT                   /gene="mtuA"
FT                   /locus_tag="SUB0473"
FT                   /product="extracellular manganese-binding protein"
FT                   /note="Previously sequenced as Streptococcus uberis
FT                   extracellular manganese-binding protein MtuA UniProt:Q70UQ6
FT                   (EMBL:SUB539135) (310 aa) fasta scores: E()=1.1e-111,
FT                   100.000% id in 310 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41168"
FT                   /db_xref="GOA:B9DRE0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE0"
FT                   /protein_id="CAR41168.1"
FT                   /translation="MKKKLSLAIMAFLGLLMLGACSVGNGRKATDGKLQVVVTNSIIAD
FT                   MTKNIAKDKIDLHSIVPIGQDPHEYEPLPEDVQKTSSADLIFYNGINLEDGGQAWFTKL
FT                   VKNAEKKKNKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGMIYAKNIAKQLKAKD
FT                   PKNKDYYQKNLDQYLAKLEKLDQEAKSKFNKIPEAKKLIVTSEGCFKYFSKAYGVPSAY
FT                   IWEINTEEEGTPDQISSLLATLKTKKPSALFVESSVDNRPMKSVSKDSGIPIYSEIFTD
FT                   SIAKKGKNGDSYYAMMKWNLDKISEGLAK"
FT   sig_peptide     457774..457860
FT                   /gene="mtuA"
FT                   /locus_tag="SUB0473"
FT                   /note="Signal peptide predicted for SUB0473 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.570 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    457786..457845
FT                   /note="1 probable transmembrane helix predicted for SUB0473
FT                   by TMHMM2.0 at aa 5-24"
FT   misc_feature    457798..458700
FT                   /gene="mtuA"
FT                   /locus_tag="SUB0473"
FT                   /note="HMMPfam hit to PF01297, Periplasmic solute binding
FT                   protein family, score 2.4e-142"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   misc_feature    457804..457836
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             458766..459488
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="SUB0474"
FT                   /product="metal cation ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41170"
FT                   /db_xref="GOA:B9DRE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE1"
FT                   /protein_id="CAR41170.1"
FT                   /translation="MITTENLTVTYDNQKEILHQININIESPGIYGILGPNGAGKSTFM
FT                   KALLNLIHYDGKVQIGKSMKSLPKHQVAYVEQRSNIDLNFPITVRECVSLGTFSDLRIG
FT                   QKVKKKQYDKVDFYLDKVGLTDYANHAIKALSGGQFQRMLVARCLVQERDYIFLDEPFV
FT                   GIDSVSESIIVNLLKELKEKGKTILVVHHDLSKVENYFDQIILLNRKLIAFGEVSQTFT
FT                   VSNLAQTYGDQLIFCGKE"
FT   misc_feature    458847..459395
FT                   /gene="mtsB"
FT                   /locus_tag="SUB0474"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-39"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    458868..458891
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    458931..458954
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    459168..459212
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             459492..460331
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="SUB0475"
FT                   /product="metal cation ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41172"
FT                   /db_xref="GOA:B9DRE2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE2"
FT                   /protein_id="CAR41172.1"
FT                   /translation="MFKFFEALMTYHFLQNALVTALVIGIVSGAVGCFIILRSMSLMGD
FT                   AISHAVLPGVALSFILGINFFIGAIVFGLLSSLLITYIKENSFIKGDTAIGITFSSFLA
FT                   LGVILIGVANSSTDLFHILFGNILAVQDSDKWLTIIVSATVLALIVLFFKELLLTSFDS
FT                   VLAKSMGYNVGFYHYLLMVLLTLVAVTAMQSVGTILIVAMLITPAATAYLYTNSLKHMI
FT                   YLSSGLGALASLLGLYLGYTFNIAAGSSIVLTSALIFAVSFFISPKQNILKRNTKKI"
FT   misc_feature    459519..460289
FT                   /gene="mtsC"
FT                   /locus_tag="SUB0475"
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family,
FT                   score 9.7e-121"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    order(459540..459608,459666..459734,459771..459839,
FT                   459897..459965,459999..460067,460077..460136,
FT                   460155..460214,460224..460292)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SUB0475 by TMHMM2.0 at aa 17-39, 59-81, 94-116, 136-158,
FT                   170-192, 196-215, 222-241 and 245-267"
FT   CDS             join(460425..460553,460555..460572,460571..460699,
FT                   460699..460734)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0476"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Streptococcus pyogenes (serotype M6)
FT                   transposase. UniProt:Q5XBH8_STRP6 (EMBL:CP000003) (97 aa)
FT                   fasta scores: E()=0.0017, 37.624% id in 101 aa, and to
FT                   Streptococcus pyogenes (serotype M6) transposase.
FT                   UniProt:Q5XBH8_STRP6 (EMBL:CP000003) (97 aa) blastp scores:
FT                   E()=0.52. CDS contains frameshifts after codons 43, 49 and
FT                   92"
FT                   /db_xref="PSEUDO:CAR41176.1"
FT   CDS             complement(460838..461650)
FT                   /transl_table=11
FT                   /locus_tag="SUB0477"
FT                   /product="putative cyclophilin type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41179"
FT                   /db_xref="GOA:B9DRE4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE4"
FT                   /protein_id="CAR41179.1"
FT                   /translation="MKKIISFALLTLSLFSLSACESIDRAIKGDKYVDEQIANKKNEQA
FT                   AKAYEAQIQKALVADKDDFPQLSTELKDNQAQVLLKTSKGDITIKLFPKFAPLAVENFL
FT                   THAKKGYYNNLTFHRVISDFMIQSGDPNGDGTGGQSIWNGKDAKIDSGNGFANEISPYL
FT                   YNIRGALAMANAGADTNGSQFFINQNSENQEKALSKEHYPKPIIEAYHKGGNPSLDGSY
FT                   TVFGQVTAGMDVVDAIAKSEVDANDKPKENIVITSITIQKDYDFKHKN"
FT   misc_feature    complement(460868..461422)
FT                   /locus_tag="SUB0477"
FT                   /note="HMMPfam hit to PF00160, Cyclophilin type
FT                   peptidyl-prolyl cis-tr, score 5e-46"
FT                   /inference="protein motif:HMMPfam:PF00160"
FT   misc_feature    complement(461591..461623)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(461594..461650)
FT                   /locus_tag="SUB0477"
FT                   /note="Signal peptide predicted for SUB0477 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.634 between residues 19 and 20"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             461855..462691
FT                   /transl_table=11
FT                   /locus_tag="SUB0478"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41181"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE5"
FT                   /protein_id="CAR41181.1"
FT                   /translation="MEISSNSKKLIIAVLLAVLGFFMFTKMASSTYVNQMNQDIVSSLD
FT                   QKKVTVMKLAASSTAASTAVTLIPGDVGSPLAENLADVSDYLLVIIIAIWLQKYLIAIV
FT                   GAISFKIFFPATCLLLILYLFSKKEILIRVAFKLALFGLMIFCIVPTSVTISNHIEKTY
FT                   QSSIQETIKKTEKENKRIDQKLQKKNQKLSLKNILGKIDGEKSKVLNTMENSLSNMIDA
FT                   VAVMIVTTCLIPILVLMSFIWLTNMIFGLSLTTDLRRFSFIGKFVRNKTQKSLGRE"
FT   sig_peptide     461855..461944
FT                   /locus_tag="SUB0478"
FT                   /note="Signal peptide predicted for SUB0478 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.788 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(461888..461956,462152..462220,462254..462322,
FT                   462518..462586)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0478 by TMHMM2.0 at aa 12-34, 100-122, 134-156 and
FT                   222-244"
FT   CDS             462818..465226
FT                   /transl_table=11
FT                   /locus_tag="SUB0479"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41183"
FT                   /db_xref="GOA:B9DRE6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE6"
FT                   /protein_id="CAR41183.1"
FT                   /translation="MAIRNQQKKGAGKKRQTKAEIEKQKAVKRMVFSILLAFVLLFAAI
FT                   RLGIFGITAYNVIRFMVGSLAYLFIFAVITYLFLFKWLRQQEGLIAGFITTFIGLLIEC
FT                   HAYLFALPTTKDKEIFTWTARLVTRDLLHFKIETFVGGGMIGALLYKPVSFLFSNIGSF
FT                   FIGALIILLGFFLMTPWDVYDLAHFAKSWLKGLADYHYRKKEERFIKREEAKAQAAQEQ
FT                   LEREAMEAEQALQMQNRSVDYETGEILEHTDIIPLEGQENQMEMLEPEIIAYESHPASE
FT                   LIDFPLDDLENISQGQDSIADGNPLDDMMAEDGDDEPVEVDFTAKANLLYKLPTIDLFA
FT                   PDRPKDQSKEKNLVRKNIKVLEDTFRSFGIDVKVERAEIGPSVTKYEIKPAVGVRVNRI
FT                   SNLADDLALALAAKDVRIEAPIPGKSLVGIEVPNSEIATVSFRELWEQSNTSEDKLLEV
FT                   PLGKAVNGKARSFDLTRMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKFLMVDPK
FT                   MVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKVGVRNIAGYNAKVED
FT                   YNSQSEQKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPS
FT                   VDVISGLIKANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQG
FT                   SFISDDDVERIVDFIKNQADADYDDAFDPGEVTENDFSSGSADASEGDPLFEEAKALVL
FT                   ETQKASASMIQRRLSVGFNRATRLMDELEEAGVIGPAEGTKPRKVLQTQ"
FT   sig_peptide     462818..462970
FT                   /locus_tag="SUB0479"
FT                   /note="Signal peptide predicted for SUB0479 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.761) with cleavage site
FT                   probability 0.378 between residues 51 and 52"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(462908..462976,462989..463057,463082..463150,
FT                   463208..463267,463280..463348)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0479 by TMHMM2.0 at aa 31-53, 58-80, 89-111, 131-150 and
FT                   155-177"
FT   misc_feature    464135..464725
FT                   /locus_tag="SUB0479"
FT                   /note="HMMPfam hit to PF01580, FtsK/SpoIIIE family, score
FT                   2.8e-75"
FT                   /inference="protein motif:HMMPfam:PF01580"
FT   misc_feature    464264..464287
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(465255..465611)
FT                   /transl_table=11
FT                   /locus_tag="SUB0480"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41189"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRE7"
FT                   /protein_id="CAR41189.1"
FT                   /translation="MITYKLIALLFIVLTPLFSQIMVKLFRLERYGIKFPDLAFVLFAL
FT                   EIALVSGKFYDNNLLPYYFIVLSLLAIAISLTLVMKSQKFHYPRFFKLFWRIGFLITLF
FT                   AYLVLVILIFSTKV"
FT   misc_feature    complement(order(465267..465335,465372..465440,
FT                   465534..465593))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0480 by TMHMM2.0 at aa 7-26, 58-80 and 93-115"
FT   CDS             465856..466281
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SUB0481"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41190"
FT                   /db_xref="GOA:B9DRE8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRE8"
FT                   /protein_id="CAR41190.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVITVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANLESAMRMIEGTARSMGFTITD"
FT   misc_feature    465877..466053
FT                   /gene="rplK"
FT                   /locus_tag="SUB0481"
FT                   /note="HMMPfam hit to PF03946, Ribosomal protein L11,
FT                   N-terminal dom, score 1.5e-35"
FT                   /inference="protein motif:HMMPfam:PF03946"
FT   misc_feature    466066..466272
FT                   /gene="rplK"
FT                   /locus_tag="SUB0481"
FT                   /note="HMMPfam hit to PF00298, Ribosomal protein L11, RNA
FT                   binding do, score 1.2e-40"
FT                   /inference="protein motif:HMMPfam:PF00298"
FT   misc_feature    466231..466278
FT                   /note="PS00359 Ribosomal protein L11 signature."
FT                   /inference="protein motif:Prosite:PS00359"
FT   CDS             466387..467076
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SUB0482"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41193"
FT                   /db_xref="GOA:B9DRE9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRE9"
FT                   /protein_id="CAR41193.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALIKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQAIIGKVSFDADKLVENFKAFNDVMVKSKPSTAKGTYMTNVSITSTQGVGI
FT                   KVDPSSL"
FT   misc_feature    466429..467049
FT                   /gene="rplA"
FT                   /locus_tag="SUB0482"
FT                   /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e
FT                   family, score 4.9e-110"
FT                   /inference="protein motif:HMMPfam:PF00687"
FT   CDS             467216..467944
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SUB0483"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41194"
FT                   /db_xref="GOA:B9DRF0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRF0"
FT                   /protein_id="CAR41194.1"
FT                   /translation="MEPKYQRILIKLSGEALAGDKGVGIDIPTVQTIAKEIAEVHQSGV
FT                   QIALVIGGGNLWRGEPAAEAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAESYIRGRALRHLEKGRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPRKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IKRVVFGEHIGTTVSNKAND"
FT   misc_feature    467231..467863
FT                   /gene="pyrH"
FT                   /locus_tag="SUB0483"
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family,
FT                   score 2.8e-59"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   CDS             467980..468537
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /gene_synonym="frr"
FT                   /locus_tag="SUB0484"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41195"
FT                   /db_xref="GOA:B9DRF1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRF1"
FT                   /protein_id="CAR41195.1"
FT                   /translation="MANAIIEKANQRFEQSFQSLSREYASIRAGRANASLLDRIQVEYY
FT                   GVPTPLNQLASITVPEARVLLISPFDKSSIKDIERAINASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENQKIAIRNIRRDAMDEAKKQEKNKEITEDELKALEKDIQKA
FT                   TDQAIKHIDGMTSEKEKELLTV"
FT   misc_feature    468034..468528
FT                   /gene="rrf"
FT                   /gene_synonym="frr"
FT                   /locus_tag="SUB0484"
FT                   /note="HMMPfam hit to PF01765, Ribosome recycling factor,
FT                   score 4.3e-91"
FT                   /inference="protein motif:HMMPfam:PF01765"
FT   CDS             468652..469506
FT                   /transl_table=11
FT                   /locus_tag="SUB0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41198"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRF2"
FT                   /protein_id="CAR41198.1"
FT                   /translation="MNELLATTVTGLIREENEQSYFVQKDGFIITLSKEEGQHAIGDMV
FT                   TGFVYLDMKQKLRMTTKAIQSTRDSYGWGDVVDVRRDLGVFVDTGIPEKEIVVSLDLLP
FT                   EMKELWPKKGDRLYIKLEVDKKDRIWGIPAEPEVFQKMADPAYNNMQNQNWPAIVYRLK
FT                   ISGTFVYLPENNMLGYIHPSERYQEPRLGQVLDARVIGFREVDRTLNLSVKPRSFEMLE
FT                   NDAQMILTYLESNGGFMTLNDKSTPDEIKATFGISKGQFKKALGGLMKAKRIKQDASGT
FT                   ELI"
FT   CDS             469590..470099
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SUB0486"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41200"
FT                   /db_xref="GOA:B9DRF3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRF3"
FT                   /protein_id="CAR41200.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEELDGIVSVRSGYTGGHVPNPSYEQVC
FT                   SKTTGHTEAVEIIFDPQKIDYSDLVELYWQQTDPTDAFGQFEDRGDNYRPVIFYFDERQ
FT                   KEIAEQSRENLQLSGRFQDPIVTQIEEAQPFYLAEDYHQAFYRKNPERYAQSSKQRHDF
FT                   LEENWH"
FT   misc_feature    469593..470066
FT                   /gene="msrA"
FT                   /locus_tag="SUB0486"
FT                   /note="HMMPfam hit to PF01625, Peptide methionine sulfoxide
FT                   reductase, score 5.4e-79"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   CDS             470096..470311
FT                   /transl_table=11
FT                   /locus_tag="SUB0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41201"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRF4"
FT                   /protein_id="CAR41201.1"
FT                   /translation="MRKSFYSWLMTQRNPKSDEPVAILADLAFDDTTFPKHSDDFEVIS
FT                   RYLEDQAIFSFNLGHFDAIWEDYLNH"
FT   misc_feature    470096..470302
FT                   /locus_tag="SUB0487"
FT                   /note="HMMPfam hit to PF06855, Protein of unknown function
FT                   (DUF1250), score 1.3e-41"
FT                   /inference="protein motif:HMMPfam:PF06855"
FT   CDS             470492..471571
FT                   /transl_table=11
FT                   /locus_tag="SUB0488"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41202"
FT                   /db_xref="GOA:B9DRF5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRF5"
FT                   /protein_id="CAR41202.1"
FT                   /translation="MQEYSVEITLNHPDDVLALFGSNERHLKLIENHLEVIIHARTERV
FT                   QIIGDDHDNVELARLTIQALQVLVGRGMMVNTSDVVTALSMAEKGTIDKFVALYEEEII
FT                   KDNNGKAIRVKTLGQKVYVDSVKKHDVVFGIGPAGTGKTFLAVTLAVTALKRGQVKRIV
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYQILGKEQTTRLMERDIIEIAPLAY
FT                   MRGRTLEDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIINGDTSQIDLPQKVKSGLVDA
FT                   SQKLQHIKAIDFVYFSASDVVRHPVVADIIKAYEHKERGGDMAGAGQNQHDIPKENAQT
FT                   SGLTSYEVIGELPEDKIDK"
FT   misc_feature    470504..470677
FT                   /locus_tag="SUB0488"
FT                   /note="HMMPfam hit to PF00013, KH domain, score 0.057"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    470822..471436
FT                   /locus_tag="SUB0488"
FT                   /note="HMMPfam hit to PF02562, PhoH-like protein, score
FT                   8.7e-136"
FT                   /inference="protein motif:HMMPfam:PF02562"
FT   misc_feature    470897..470920
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             471616..472191
FT                   /transl_table=11
FT                   /locus_tag="SUB0489"
FT                   /product="uracil DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41203"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRF6"
FT                   /protein_id="CAR41203.1"
FT                   /translation="MDKIFKEIMADPDNKAYTEKGIEPLYSSPKTAKIVIVGQAPGIIA
FT                   QETKLFWNDRSGLKLREWLGVDNDTFYYSGHFAILPMDFYYPGKGKSGDLPPRKNFAPK
FT                   WHKRLLDRLEEVELIILVGQYAQNYYLGERQKKNLTETVKAFQDYLPTYFPLVHPSPRN
FT                   QIWLKRNPWFEEEVVPQLQKKVQKILRS"
FT   misc_feature    471694..472173
FT                   /locus_tag="SUB0489"
FT                   /note="HMMPfam hit to PF03167, Uracil DNA glycosylase
FT                   superfamily, score 5.2e-08"
FT                   /inference="protein motif:HMMPfam:PF03167"
FT   CDS             472284..472784
FT                   /transl_table=11
FT                   /locus_tag="SUB0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41204"
FT                   /db_xref="GOA:B9DRF7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRF7"
FT                   /protein_id="CAR41204.1"
FT                   /translation="MYIEMIDETGLVSQEIMEQTLDLLNFAARKTGKDEKEMSVTFVTN
FT                   ERSHELNLEYRDTDRPTDVISLEYKPESPILFDERDLEENPDLAEMLSEFDAYIGELFI
FT                   SIDKAKEQAQEYGHSFEREMGFLAVHGFLHINGYDHYTPEEEKEMFTLQEEILTAYGLT
FT                   RQS"
FT   misc_feature    472410..472757
FT                   /locus_tag="SUB0490"
FT                   /note="HMMPfam hit to PF02130, Uncharacterized protein
FT                   family UPF0054, score 5.6e-28"
FT                   /inference="protein motif:HMMPfam:PF02130"
FT   CDS             472762..473166
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="SUB0491"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41207"
FT                   /db_xref="GOA:B9DRF8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRF8"
FT                   /protein_id="CAR41207.1"
FT                   /translation="MALQDNHNSQRKWKNRTVTSSLEFALTGILTAVQEERNLKSHLVS
FT                   AFLASLAGIIFKISAVEWLFLLLAIFLVICLEIVNSAIENVVDLASSYHFSMLAKKAKD
FT                   MAAGAVLVMSLYAVLTGLIIFLPKIFALIF"
FT   misc_feature    472813..473142
FT                   /gene="dgk"
FT                   /locus_tag="SUB0491"
FT                   /note="HMMPfam hit to PF01219, Prokaryotic diacylglycerol
FT                   kinase, score 1.8e-44"
FT                   /inference="protein motif:HMMPfam:PF01219"
FT   misc_feature    order(472948..473016,473074..473142)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0491 by TMHMM2.0 at aa 63-85 and 105-127"
FT   misc_feature    472990..473025
FT                   /note="PS01069 Prokaryotic diacylglycerol kinase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01069"
FT   CDS             473188..474087
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="SUB0492"
FT                   /product="GTP-binding protein Era homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41209"
FT                   /db_xref="GOA:B9DRF9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRF9"
FT                   /protein_id="CAR41209.1"
FT                   /translation="MSFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIM
FT                   GIYTTDKEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVDTVLFMVPADEKRGKGDDM
FT                   IMERLKNAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALQGNNVPTLIS
FT                   LLTDNLEEGFQYFPEDQITDHPERFLVSEMIREKVLHLTQQEIPHSVAVVIESMKRDQV
FT                   TDKVHIRATIMVERDSQKGIIIGKQGSMLKKIGQMARRDIELMLGDKVYLETWVKVKKN
FT                   WRDKKLDLADFGYNQKEY"
FT   misc_feature    473203..473559
FT                   /gene="era"
FT                   /locus_tag="SUB0492"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 9e-43"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    473221..473244
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    473875..474069
FT                   /gene="era"
FT                   /locus_tag="SUB0492"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 1.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   CDS             474461..474847
FT                   /transl_table=11
FT                   /locus_tag="SUB0494"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41211"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG0"
FT                   /protein_id="CAR41211.1"
FT                   /translation="MKRKISLFLFLASIFATTNSVFAGARQIGQLSHFRITPSFSGTSY
FT                   LQKMNDSYYVVNLESKNPQIKVKHYLANSQGVRRSDIDMTWTGQRGVYTNFAKSHYIYN
FT                   LNLARENFWDKGFFIDGSWSPDSK"
FT   sig_peptide     474461..474529
FT                   /locus_tag="SUB0494"
FT                   /note="Signal peptide predicted for SUB0494 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.527 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    474479..474547
FT                   /note="1 probable transmembrane helix predicted for SUB0494
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS             474906..475697
FT                   /transl_table=11
FT                   /locus_tag="SUB0495"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41213"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG1"
FT                   /protein_id="CAR41213.1"
FT                   /translation="MITLKLLPYKKTFLLICLLFFLLIYNQAFFHILFFDDSAADIVKV
FT                   HGESVKFKFFYGLLSLNNGLFEYNFFQSFMFPLLMIVIGKAYHYLKNRYCRYYLGRTQS
FT                   YYPTIKKLKIILSILSVFIFSLILVFIITVSKGVGKFDLSGIEYYFNNHSILSFFGTST
FT                   INYLIYYFLVKSFALLAESFLIFKMIDYFNNFTKSALVYLLFMWGTAPILYSFLPFYLV
FT                   PMSHIMITSYGNVSLWMILASYLPICIFYAYLKRKNAYDIT"
FT   sig_peptide     474906..475025
FT                   /locus_tag="SUB0495"
FT                   /note="Signal peptide predicted for SUB0495 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.839) with cleavage site
FT                   probability 0.472 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(474942..475010,475110..475178,475239..475307,
FT                   475377..475445,475503..475571,475599..475667)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0495 by TMHMM2.0 at aa 13-35, 69-91, 112-134, 158-180,
FT                   200-222 and 232-254"
FT   CDS             475684..476337
FT                   /transl_table=11
FT                   /locus_tag="SUB0496"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41215"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG2"
FT                   /protein_id="CAR41215.1"
FT                   /translation="MILHKFRYRVITTILTWTICFLLLTTYNENKNLDLIHLVINQFLN
FT                   PLSFSPGQKLHYLTIVMLLGLYFLSFFRTYRVIMETASTIKGMLKYHSNTLFCYQLSLY
FT                   NILMGFYIRDFIYLIGCIITSLFVIKPTTVTIMGLAYLVCIWFLVDTLTYFWIVYFCND
FT                   HLAIILFICLEIIFRYMLMKLFLVVVVVTILCLIILSLKEVTGVRNSKWKHNKR"
FT   misc_feature    order(475702..475761,475846..475899,476026..476130,
FT                   476146..476214,476233..476286)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0496 by TMHMM2.0 at aa 7-26, 55-72, 115-149, 155-177 and
FT                   184-201"
FT   CDS             476300..476929
FT                   /transl_table=11
FT                   /locus_tag="SUB0497"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41217"
FT                   /db_xref="GOA:B9DRG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG3"
FT                   /protein_id="CAR41217.1"
FT                   /translation="MLEIQNGSIIKGNRVLLDEISLKFENQRVYGLVGINGSGKTMILK
FT                   AITGFHRLTKGLVYQNGTIIGPGNRTISKTGLVLGDQEFISYFTLKENLTLIKKICPNA
FT                   KTIDLEYWIKLFQIEKYQDIPYKDLSLGTKKKMVIIQAFMDNPDILILDEPMNALDEKS
FT                   VAITKMLIKKQKEKGLVIMTSHYKNDIEDLCDTIIHVQEGKILKKD"
FT   misc_feature    476378..476908
FT                   /locus_tag="SUB0497"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    476399..476422
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             477357..478097
FT                   /transl_table=11
FT                   /locus_tag="SUB0498"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41219"
FT                   /db_xref="GOA:B9DRG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG4"
FT                   /protein_id="CAR41219.1"
FT                   /translation="MNIYILEDNLSQLFYLEKLIKQILLQKNRQNCKVKTFEQPKDLIN
FT                   NVKERGNHQLFFLDIELGQNDKLGLLTAKKIKELDPLAIIVFISSHSEFLPLTFRYQTE
FT                   AFDFIDKNLCTKEKIERITRAINFVINNSHSMKTSFFFENQNNILQIPFEKIFFIETSS
FT                   ESHRLILHGKNEIIEFYGSISEVLKQEPRLLKSHRSYIINPNNVVKIDKKERTIYFERG
FT                   IKCYASRSKLKFITNSISNIRKEK"
FT   misc_feature    477357..477758
FT                   /locus_tag="SUB0498"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 0.00014"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    477792..478076
FT                   /locus_tag="SUB0498"
FT                   /note="HMMPfam hit to PF04397, LytTr DNA-binding domain,
FT                   score 4.4e-26"
FT                   /inference="protein motif:HMMPfam:PF04397"
FT   CDS             478120..479439
FT                   /transl_table=11
FT                   /locus_tag="SUB0499"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41220"
FT                   /db_xref="GOA:B9DTX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX4"
FT                   /protein_id="CAR41220.1"
FT                   /translation="MEKICDIAVPIFLFYFITKRKIKFNEVVIGVSIRLLLILLFVFFY
FT                   EKLIISDIFTYLSLPLYMFLFTSYIYKFNVNLLTIFYALFPITLWNLIYRSIVFYLLPI
FT                   LGITNSYFQKSLLFLPVYLLSVTILVLFLEVFHYDFSTFSEQQFSKQEKKLIRFVNFFM
FT                   ITYYFMIQIISFFDYQLAIDTLFYRQLIVTLYFLLFLGILNSLDKQIREKLQKEIIFQK
FT                   EIQFQNLENYSRHVEELYDQVRHFRHDYANILSTLKIGIEEDDMTIVKDVFEKVLKDSN
FT                   RELESHKYDITRLVNIEDRALKSLLASKFIRMEEKGITVSLEIPYKITICEMELIDFIT
FT                   IVSIFIDNAIEETFLSKNPKITFAFFEDSNRQICIIENSTRNNQIDITNIFNEFETSKG
FT                   KGRGIGLYKVSRILKKYHSVNLKTQSLDYKFTQILEIIFE"
FT   misc_feature    order(478198..478254,478264..478332,478351..478419,
FT                   478462..478530,478591..478659,478669..478737)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0499 by TMHMM2.0 at aa 27-45, 49-71, 78-100, 115-137,
FT                   158-180 and 184-206"
FT   misc_feature    479116..479436
FT                   /locus_tag="SUB0499"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             479432..479548
FT                   /transl_table=11
FT                   /locus_tag="SUB0500"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41222"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX5"
FT                   /protein_id="CAR41222.1"
FT                   /translation="MNRNYLYLEKFPILIAAFLVVLLKIEFIVRHNDFPPII"
FT   misc_feature    479450..479518
FT                   /note="1 probable transmembrane helix predicted for SUB0500
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS             complement(479631..481784)
FT                   /transl_table=11
FT                   /locus_tag="SUB0501"
FT                   /product="bacteriocin transport/processing ATP-binding
FT                   protein"
FT                   /note="Similar to Leuconostoc mesenteroides mesentericin
FT                   y105 transport/processing ATP-binding protein MesdD
FT                   UniProt:MESD_LEUME (EMBL:LMMESCDEY) (722 aa) fasta scores:
FT                   E()=3.6e-125, 51.676% id in 716 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41224"
FT                   /db_xref="GOA:B9DTX6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX6"
FT                   /protein_id="CAR41224.1"
FT                   /translation="MFYYYKSYTSQVDENDCGVAALASIAKYYGSHYSISYFRQLANTT
FT                   REGTTALGIINAANALGFKTKAIKADISLFDIKNLDFPLIVHVIKNNELAHYYIVYKSY
FT                   RNHLLIGDPDPSVKIVKMAKDKFAEEWTGVALLFKPSRNYSPTNQNFFSPVSYTKVISK
FT                   RLTLIFLITIISLIITLISILSSYYLQATIDFYIPNKMFSALEIITFGLISTFILQEIL
FT                   TYFRDYLLILLNQKLSIDIILAYIQHLFKLPLSFFSTRRTGEITSRFNDANSIIDAIAS
FT                   TILTIFLDFLMTICVGMTLFFQNKILFTITLVGIPIYTILILSFYKSFKKMNQELMQAN
FT                   ALVSSTIIEDLNGIETIKALSCEEKSFKRINDEFREVLQKSFRLQKLTVLQSALKKGTQ
FT                   QILNVIILWVGAKLVISGKISIGQLITFNALLVYFTTPIENIINLQNKIQSAKEANNRL
FT                   NEVYYEKSEFENNQNTKLKIDKLRTIDLKNISFKYGIGHDLLKNINLTIREGEKICIIG
FT                   TSGSGKTTLAKLIVGFQKPTEGKITINNYDMDKINKKTIRYFINYLPQQPYLFTGTIIE
FT                   NLTFGIYKDISQEKIEEACRIAAILGDIEKMPLKFNTKFSDGFGLSGGQKQRIALVRAL
FT                   LSDSPILILDEATSGLDIQTEKLIINNLLKLKNKTIIFIAHRLAIAEKTDRIIVMNRGK
FT                   ISEMGSHKELISRKGAYYQLLNS"
FT   misc_feature    complement(479706..480257)
FT                   /locus_tag="SUB0501"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(479880..479924)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(480213..480236)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(480471..481292)
FT                   /locus_tag="SUB0501"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 1.4e-52"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    complement(order(480507..480575,480810..480869,
FT                   480882..480950,481011..481070,481113..481181,
FT                   481218..481286))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0501 by TMHMM2.0 at aa 167-189, 202-224, 239-258,
FT                   279-301, 306-325 and 404-426"
FT   misc_feature    complement(481356..481760)
FT                   /locus_tag="SUB0501"
FT                   /note="HMMPfam hit to PF03412, Peptidase C39 family, score
FT                   5.7e-63"
FT                   /inference="protein motif:HMMPfam:PF03412"
FT   CDS             join(482015..482143,482147..482245)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0502"
FT                   /product="putative bacteriocin (pseudogene)"
FT                   /note="Similar to Brochothrix campestris bacteriocin BrcB
FT                   UniProt:O85757_9LIST (EMBL:AF075600) (60 aa) fasta scores:
FT                   E()=1, 42.373% id in 59 aa. CDS contains a nonsense
FT                   mutation (ochre) after codon 43"
FT   CDS             join(482262..482288,482288..482446,482446..482571,
FT                   482571..482699)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0504"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Similar to Streptococcus mutans putative immunity
FT                   protein, blpl-like. UniProt:Q8DS96_STRMU (EMBL:AE015016)
FT                   (133 aa) fasta scores: E()=9e-06, 34.307% id in 137 aa. CDS
FT                   contains frameshifts after codons 8, 62 and 103"
FT                   /db_xref="PSEUDO:CAR41229.1"
FT   CDS             482825..483091
FT                   /transl_table=11
FT                   /locus_tag="SUB0505"
FT                   /product="putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41231"
FT                   /db_xref="GOA:B9DTX8"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX8"
FT                   /protein_id="CAR41231.1"
FT                   /translation="MEKLLFQKRKVDILMNSNIEFDSIDTELLEKVIGGKNNWQANVSG
FT                   ILAAGAAGAAIGAPVCGLACGYIGAKTAITLWAGVTGATGGFK"
FT   misc_feature    482960..483028
FT                   /note="1 probable transmembrane helix predicted for SUB0505
FT                   by TMHMM2.0 at aa 46-68"
FT   CDS             483102..483302
FT                   /transl_table=11
FT                   /locus_tag="SUB0506"
FT                   /product="putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41232"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTX9"
FT                   /protein_id="CAR41232.1"
FT                   /translation="MDKHLVLSNQQLLDVVGGNAPGNAVLGGLGGLQTGIKYCKVPHPV
FT                   LKGVCIVGFTTAGAYLAYKAN"
FT   misc_feature    483222..483290
FT                   /note="1 probable transmembrane helix predicted for SUB0506
FT                   by TMHMM2.0 at aa 41-63"
FT   CDS             483496..483807
FT                   /transl_table=11
FT                   /locus_tag="SUB0508"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41234"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY0"
FT                   /protein_id="CAR41234.1"
FT                   /translation="MKIEKDKYIVFNMFLLLKGLLPLSLTTILIIVFGNVLKIDSWKYT
FT                   KLILSAVTFELVCFLLSRPKDKHYLSLKATIQKFSTFIRQTKYFSSKFSNINILTKNT"
FT   misc_feature    483538..483606
FT                   /note="1 probable transmembrane helix predicted for SUB0508
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS             483979..484224
FT                   /transl_table=11
FT                   /locus_tag="SUB0509"
FT                   /product="putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41236"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY1"
FT                   /protein_id="CAR41236.1"
FT                   /translation="MKTKSSKQFTELTVKDLSAVIGGAKGVCKYVYPGSNGYACRYPNG
FT                   EWGYIVTKSNFEATKDVIVNGWVSSLGGGYFHGNRG"
FT   CDS             484227..484526
FT                   /transl_table=11
FT                   /locus_tag="SUB0510"
FT                   /product="putative bacteriocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41238"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY2"
FT                   /protein_id="CAR41238.1"
FT                   /translation="MKIDNNEIINDVYNLILSKSLKNEERVILTRFKDNIVNSKNVKKD
FT                   ILELSEELRQLAVKNISRKEVMSRELNEFYNKISAIKEKELNIGRGIGSFGVVR"
FT   CDS             484532..484669
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0510A"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Similar to the C-terminal region of Streptococcus
FT                   mutans hypothetical protein SMU.1914c. UniProt:Q8DS95_STRMU
FT                   (EMBL:AE015016) (76 aa) fasta scores: E()=1.5e-09, 76.596%
FT                   id in 47 aa"
FT   CDS             join(484698..484703,484705..485130)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SUB0511"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptococcus mutans putative immunity
FT                   protein, blpl-like. UniProt:Q8DS96_STRMU (EMBL:AE015016)
FT                   (133 aa) fasta scores: E()=1.2e-06, 33.577% id in 137 aa.
FT                   CDS contains a frameshift after codon 2"
FT                   /db_xref="PSEUDO:CAR41242.1"
FT   CDS             485369..485596
FT                   /transl_table=11
FT                   /gene="pedA"
FT                   /locus_tag="SUB0512"
FT                   /product="putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41244"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY4"
FT                   /protein_id="CAR41244.1"
FT                   /translation="MSKMKQFKVLNEELLKKTLGGTNVAPGIYCVDKNGKAKCSVDYKE
FT                   LWGYTGQVIGNGWINYGPWAPRPGFGVIIP"
FT   CDS             485648..485992
FT                   /transl_table=11
FT                   /locus_tag="SUB0513"
FT                   /product="putative bacteriocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41245"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY5"
FT                   /protein_id="CAR41245.1"
FT                   /translation="MNSKYRNKMGTKEELVVNEFRKLCNDTELKHFPELNTLIVTYYDK
FT                   LNQENKAYFRLKLVAELSNELSYYLLKNRFQAPKSVIDFSLLIAKSQSQFRGKLATLQM
FT                   LAFSLMNSLK"
FT   CDS             486025..486255
FT                   /transl_table=11
FT                   /locus_tag="SUB0514"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the N-terminal region of Clostridium
FT                   perfringens hypothetical protein CPE0752
FT                   UniProt:Q8XMD7_CLOPE (EMBL:BA000016) (112 aa) fasta scores:
FT                   E()=0.058, 33.803% id in 71 aa. Possible gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41247"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY6"
FT                   /protein_id="CAR41247.1"
FT                   /translation="MKARKKDLSINVTNLILNSVVKEERRLLITYNNHIEDYEDIENSM
FT                   MNLFNERRLLAVKNISSKEVMSRHVNDFYKK"
FT   CDS             486328..486696
FT                   /transl_table=11
FT                   /locus_tag="SUB0515"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41249"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY7"
FT                   /protein_id="CAR41249.1"
FT                   /translation="MKLKVFIPISLSTILIVVFGNVLKADSWTITKLILSAVIFELVCF
FT                   LLSRPKDKHYLALKATIQKFSIFIRQTKYFSIFYLFFLIYELWNETNVLNLLFYIHIIF
FT                   VFYSIGFILSMNNVQMKE"
FT   sig_peptide     486328..486402
FT                   /locus_tag="SUB0515"
FT                   /note="Signal peptide predicted for SUB0515 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.828 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(486340..486396,486409..486468,486526..486594,
FT                   486604..486672)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0515 by TMHMM2.0 at aa 5-23, 28-47, 67-89 and 93-115"
FT   CDS             486817..487116
FT                   /transl_table=11
FT                   /locus_tag="SUB0516"
FT                   /product="putative bacteriocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41255"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY8"
FT                   /protein_id="CAR41255.1"
FT                   /translation="MSYLKWFSGGKDRKEGAVTILDLLIALHAQGNNPSQRFVKVLRQY
FT                   RDELQSNGTSVPLILSRMNVELASVLKEDKISLTSQESDYLKQLRAISNIRYGY"
FT   CDS             487296..488117
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="SUB0517"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41256"
FT                   /db_xref="GOA:B9DTY9"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTY9"
FT                   /protein_id="CAR41256.1"
FT                   /translation="MPELPEVETVRRGLENLIIGKEIASVTVKVPKMIVSNPDTFAGDL
FT                   MGQEILSIGRRGKYLIFHFTDLVMVSHLRMEGKYLLFEGGIPENKHFHFFFHFTDGSTL
FT                   VYQDVRKFGTLELLAQDGLDLYFSQRKLGPEPTKNAFKLKAFEAALRLSKKPIKPLLLE
FT                   QKLVVGLGNIYVDEVLWAAQVHPLRLASELKKAEVKRIHDQTIAILAFAVDKGGSTIRT
FT                   YQNTLGMNGSMQDYLQVYGQKGSPCPRCGTEIEKIKVGGRGTHFCPKCQKI"
FT   misc_feature    487296..487649
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="SUB0517"
FT                   /note="HMMPfam hit to PF01149, Formamidopyrimidine-DNA
FT                   glycosylase N-, score 4.8e-58"
FT                   /inference="protein motif:HMMPfam:PF01149"
FT   misc_feature    487689..487967
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="SUB0517"
FT                   /note="HMMPfam hit to PF06831, Formamidopyrimidine-DNA
FT                   glycosylase H2, score 5.4e-43"
FT                   /inference="protein motif:HMMPfam:PF06831"
FT   misc_feature    488025..488114
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="SUB0517"
FT                   /note="HMMPfam hit to PF06827, Zinc finger found in FPG and
FT                   IleRS, score 1.5e-11"
FT                   /inference="protein motif:HMMPfam:PF06827"
FT   misc_feature    488034..488108
FT                   /note="PS01242 Formamidopyrimidine-DNA glycosylase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01242"
FT   CDS             488114..488701
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SUB0518"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41259"
FT                   /db_xref="GOA:B9DTZ0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ0"
FT                   /protein_id="CAR41259.1"
FT                   /translation="MTVIGITGGIASGKSTLVKAIREAGFKVIDADQVVHDLQAKGGRL
FT                   YEALVQTFGQGILTSDGHLDRPKLSEMIFSSPENRELSSSIQNHIIHEELAKAKDTLAA
FT                   TEAIFFMDIPLLIELGYQEWFDAIWLVYVSPDVQIQRLMSRNHYSKEQAEKRLATQLPM
FT                   DQKKKFADVIIDNNGSIQDLRDQLDQALKGLK"
FT   misc_feature    488117..488659
FT                   /gene="coaE"
FT                   /locus_tag="SUB0518"
FT                   /note="HMMPfam hit to PF01121, Dephospho-CoA kinase, score
FT                   2.4e-52"
FT                   /inference="protein motif:HMMPfam:PF01121"
FT   misc_feature    488135..488158
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             488711..489361
FT                   /transl_table=11
FT                   /locus_tag="SUB0519"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41261"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ1"
FT                   /protein_id="CAR41261.1"
FT                   /translation="MASFIPMTPWTGKHLWSLEPVSLLVLVLGLILFGLGESFLVLANF
FT                   GSAPWTILSLGLSQTTGMPLGWMTLLISSLIMLLWIPLHIKPGLGTVLNILIIAFVIGE
FT                   VVSHVQPPQSLLLRIILLMSGVLLVGIASALYLTSHKGAGPRDGLLVGLCLLTGWRVAI
FT                   VRTLLEGTVSLIGWFFGGPLGIGTLCFAFGVGWAMQLSLWVLSKFYKALNVGN"
FT   misc_feature    488711..488842
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    order(488771..488839,488897..488965,488984..489043,
FT                   489053..489121,489155..489214,489257..489325)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0519 by TMHMM2.0 at aa 21-43, 63-85, 92-111, 115-137,
FT                   149-168 and 183-205"
FT   misc_feature    488774..489016
FT                   /locus_tag="SUB0519"
FT                   /note="HMMPfam hit to PF02588, Uncharacterized BCR, YitT
FT                   family COG1284, score 1.4e-10"
FT                   /inference="protein motif:HMMPfam:PF02588"
FT   misc_feature    489062..489304
FT                   /locus_tag="SUB0519"
FT                   /note="HMMPfam hit to PF02588, Uncharacterized BCR, YitT
FT                   family COG1284, score 3.1e-08"
FT                   /inference="protein motif:HMMPfam:PF02588"
FT   misc_feature    489260..489301
FT                   /note="PS00099 Thiolases active site."
FT                   /inference="protein motif:Prosite:PS00099"
FT   CDS             489473..490972
FT                   /transl_table=11
FT                   /locus_tag="SUB0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41265"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ2"
FT                   /protein_id="CAR41265.1"
FT                   /translation="MATVTIAKGNQPVDIQLNMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLSGIPVFLADIKGDLSNLAKAGQVTEKLQARLDKLGISDYQAQAFPIRLWDVFSEAGQ
FT                   PVRTTISEMGPLMLARLMDLNDTQTGVLNIVFKIADERGWLLIDLKDLQAILKEVSDHS
FT                   SAYSGQYGNIAKQSIGAIQRNLLTLEQEGADLFFGEPALDLADFIQLDVASGQGAINVL
FT                   NATKLFNSPTLYTTFLLWMLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHALRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVATVITELEVGEALISVLNEKGQPSVVERAYIMPPRSSFEQLTDGELQTLVQ
FT                   SSPFASKYGQAIDRESAFEKLAQKVLGEEKAAQEEALRLEQEKAAKEAAKEREAADRQA
FT                   RRSMGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRK"
FT   misc_feature    489473..490969
FT                   /locus_tag="SUB0520"
FT                   /note="HMMPfam hit to PF05872, Bacterial protein of unknown
FT                   function (DUF85, score 0"
FT                   /inference="protein motif:HMMPfam:PF05872"
FT   misc_feature    489554..489577
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             491092..492267
FT                   /transl_table=11
FT                   /gene="pmrA"
FT                   /locus_tag="SUB0521"
FT                   /product="multi-drug resistance efflux pump"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41266"
FT                   /db_xref="GOA:B9DTZ3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ3"
FT                   /protein_id="CAR41266.1"
FT                   /translation="MKVAWLGTFFTGASFSLVMPFMALYVEELGVAKNQVEWYAGLAVA
FT                   ISAFASAVFAPIWGRLADRYGRKPMMIRASLMMTFTMGGLAFIPNVQWLLVLRLLNGIF
FT                   AGYVPNSTALIASQVPRDKSGYALGTLGTGVTAGMLIGPLIGGVLAEMLGIRLVFLLVG
FT                   LILLLCTFLTVHFVKEDFKPVNKAEVVPTRLILKQVKSRKIMLSLFVTSMIIQISAQSV
FT                   APILPLYIRHLGQVHNLMFISGLIVSAMGVSSLLSSSTLGKLGDKIGNHRMLLLALAYS
FT                   FVMYFFSALATTSIQLGVLRFAYGFGVGALMPSINSLLTRMTPREGISRIFSFNQMFMN
FT                   IGQVIGPFIGSNVAILFGYRSVFFVTSAIVFINLIWCMINFRKYLKVREIA"
FT   misc_feature    491092..492264
FT                   /gene="pmrA"
FT                   /locus_tag="SUB0521"
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 5.7e-05"
FT                   /inference="protein motif:HMMPfam:PF00083"
FT   misc_feature    order(491101..491169,491203..491271,491314..491382,
FT                   491473..491541,491554..491622,491713..491781,
FT                   491809..491877,491911..491970,491980..492048,
FT                   492082..492141,492154..492222)
FT                   /note="11 probable transmembrane helices predicted for
FT                   SUB0521 by TMHMM2.0 at aa 4-26, 38-60, 75-97, 128-150,
FT                   155-177, 208-230, 240-262, 274-293, 297-319, 331-350 and
FT                   355-377"
FT   misc_feature    491101..492156
FT                   /gene="pmrA"
FT                   /locus_tag="SUB0521"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.9e-61"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS             492264..492410
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /gene_synonym="rpmG2"
FT                   /locus_tag="SUB0521A"
FT                   /product="50S ribosomal protein L33 2"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0521A"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41267"
FT                   /db_xref="GOA:B9DTZ4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ4"
FT                   /protein_id="CAR41267.1"
FT                   /translation="MRVKINLKCSECGSKNYLTSKNKTTHPDKIKVPKYCPKERKVTLH
FT                   VES"
FT   CDS             492456..492692
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="SUB0522"
FT                   /product="putative protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41268"
FT                   /db_xref="GOA:B9DTZ5"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ5"
FT                   /protein_id="CAR41268.1"
FT                   /translation="MYNLLLTVLLVLSVLLVIAIFLQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAILVFFWLAIALVLAVLSSK"
FT   sig_peptide     492456..492566
FT                   /gene="secG"
FT                   /locus_tag="SUB0522"
FT                   /note="Signal peptide predicted for SUB0522 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972) with cleavage site
FT                   probability 0.548 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    492459..492686
FT                   /gene="secG"
FT                   /locus_tag="SUB0522"
FT                   /note="HMMPfam hit to PF03840, Preprotein translocase SecG
FT                   subunit, score 8.3e-30"
FT                   /inference="protein motif:HMMPfam:PF03840"
FT   misc_feature    order(492459..492527,492612..492680)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0522 by TMHMM2.0 at aa 2-24 and 53-75"
FT   CDS             492773..495085
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /gene_synonym="vacB"
FT                   /locus_tag="SUB0523"
FT                   /product="putative exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41270"
FT                   /db_xref="GOA:B9DTZ6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ6"
FT                   /protein_id="CAR41270.1"
FT                   /translation="MRENIIQYLKEHGKSDINTIAAALDMAGAKKFPSLIKEISQMESK
FT                   RLLRFSDDGTIALRKPKEEKKEITIQGVFRANKAGFGFLHVNDDEDDMFIGRNDVGYAI
FT                   DGDTVEVIVKKTGDRLKGTAAEAKVVGIVERSLQTVVGRFILDDEKPKYAGYIKSKNQK
FT                   IQQKIYIKKEPVLLDGTEIIKVDIEKYPTRGHDYFVGNVRDIVGHQGDVGIDVLEVLES
FT                   MDIVSEFPDDVLAEANAISDSPSSKDLIGRVDLRQEITFTIDGADAKDLDDAIHIKPLA
FT                   NGNYELGVHIADVSYYVTEGSALDREAVARGTSVYVTDRVVPMLPERLSNGICSLNPNV
FT                   DRLTQSAIMEIDSNGRVLNHQICQSVIKTTYRMTYSAVNDMIAGNQESLETYAAIAESV
FT                   EHMVKLHKILEKMRVKRGALNFDTSEARIIVNDKGMPVDIVVRQRGIAERMIESFMLAA
FT                   NECVAEHFAKAKLPFIYRIHEEPKAEKLQKFIDYASVFGIQIQGTANKITQEALQNFMA
FT                   KVEGKPGAEVLNMMLLRSMQQARYSENNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMIR
FT                   DYTQATEDKRDHFAQVIPELASSSSRLERRAIDAERVVEAMKKAEYMEEYVGDEFDGIV
FT                   ASVVKFGLFVELPNTIEGLIHITSLPEYYQYNERTMTLQGEKSGKVFKVGQAIRVKLTK
FT                   ADKETGDIDFEYLPSEFDVIEKVSKETKSKAHNHKGPRHQKKTPKTEQEEKAGSKKRKS
FT                   RKPFYKDVAKKKSRKRS"
FT   misc_feature    493289..494401
FT                   /gene="rnr"
FT                   /gene_synonym="vacB"
FT                   /locus_tag="SUB0523"
FT                   /note="HMMPfam hit to PF00773, RNB-like protein, score
FT                   1.9e-123"
FT                   /inference="protein motif:HMMPfam:PF00773"
FT   misc_feature    494414..494488
FT                   /note="PS01175 Ribonuclease II family signature."
FT                   /inference="protein motif:Prosite:PS01175"
FT   misc_feature    494642..494893
FT                   /gene="rnr"
FT                   /gene_synonym="vacB"
FT                   /locus_tag="SUB0523"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   6.7e-16"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS             495088..495555
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SUB0524"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41271"
FT                   /db_xref="GOA:B9DTZ7"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DTZ7"
FT                   /protein_id="CAR41271.1"
FT                   /translation="MAKGEGNLLAQNKKASHDYHIVETIEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLMNVHIAPFEQGNIWNADPERTRKLLLKKREINHLANELKGTGMT
FT                   LIPLKVYLKDGFAKILLGLAKGKHDYDKRESIKRREQDRDIKRVMKSINAR"
FT   misc_feature    495106..495309
FT                   /gene="smpB"
FT                   /locus_tag="SUB0524"
FT                   /note="HMMPfam hit to PF01668, SmpB protein, score 5.3e-39"
FT                   /inference="protein motif:HMMPfam:PF01668"
FT   misc_feature    495166..495204
FT                   /note="PS01317 Protein smpB signature."
FT                   /inference="protein motif:Prosite:PS01317"
FT   CDS             complement(495584..496510)
FT                   /transl_table=11
FT                   /gene="csbB"
FT                   /locus_tag="SUB0525"
FT                   /product="putative glucosyl transferase"
FT                   /note="Similar to SUB0703, 66.450% identity (66.450%
FT                   ungapped) in 307 aa overlap (1-307:2-308)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41273"
FT                   /db_xref="GOA:B9DTZ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ8"
FT                   /protein_id="CAR41273.1"
FT                   /translation="MKLLSIIVPCFNEEETIPIFFKQMQVIEHAMTQDLSFEYIFIDDG
FT                   SKDKTLDILRQLHANHANVHYLSFSRNFGKEAGLLAGLEEAKGDYITVMDADLQDPPEL
FT                   IPMMYAQLQKGYDVVGTRRINRKGEPFIRSICSKLFYYLIAKISDTEMIDGVRDFRLMT
FT                   RQVLESILELGEVNRFSKGIFSWVGFKTTYISYDNRERQKGKTSWHFFDLIRYSLDGFI
FT                   NFSEVPLALATWVGTLSFLLSLLAIIFIVVRKLLFDDPVSGWASTVSIILFMGGIQLFC
FT                   MGIIGKYISKIFLETKKRPVYIVKEKK"
FT   misc_feature    complement(order(495653..495721,495755..495823))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SUB0525 by TMHMM2.0 at aa 230-252 and 264-286"
FT   misc_feature    complement(495998..496498)
FT                   /gene="csbB"
FT                   /locus_tag="SUB0525"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase, score
FT                   1e-34"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   CDS             complement(496611..496988)
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="SUB0526"
FT                   /product="putative lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41275"
FT                   /db_xref="GOA:B9DTZ9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B9DTZ9"
FT                   /protein_id="CAR41275.1"
FT                   /translation="MKALHTCIRVKNLEESLAFYTTAFPFKETRRRDFPDSKFTLVYLA
FT                   LEGEDYELELTYNYGHEAYNLGNGYGHIAIGSEDFQADYDKHVQAGYPVTDIKGLTDKS
FT                   ARYYFIQDPDGYKIEVIDLNR"
FT   misc_feature    complement(496629..496985)
FT                   /gene="gloA"
FT                   /locus_tag="SUB0526"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Di, score 9.8e-22"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   misc_feature    complement(496752..496790)
FT                   /note="PS00935 Glyoxalase I signature 2."
FT                   /inference="protein motif:Prosite:PS00935"
FT   CDS             complement(497001..497663)
FT                   /transl_table=11
FT                   /locus_tag="SUB0527"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41277"
FT                   /db_xref="GOA:B9DU00"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU00"
FT                   /protein_id="CAR41277.1"
FT                   /translation="MDDIRKRIHDAYYFRTAVRVYNDQKISDDDLNLILDGAWRSPSSV
FT                   GLEGWRFVVLENQDIKSEIKEVAWGAQYQLETASHFILLLAEKNARYDGQSHLDSLIRR
FT                   GITDEDGLKNRLKTYEEFQKRDMDMADNPRALFDWTAKQTYIALGSMMTNAALMGIDSC
FT                   PIEGFDYQKVDDILAKHGVIDPEKEGIASMLSLGYRLRDPRHPQTRKAREDVISIVK"
FT   misc_feature    complement(497070..497630)
FT                   /locus_tag="SUB0527"
FT                   /note="HMMPfam hit to PF00881, Nitroreductase family, score
FT                   1.3e-44"
FT                   /inference="protein motif:HMMPfam:PF00881"
FT   CDS             497900..498280
FT                   /transl_table=11
FT                   /locus_tag="SUB0528"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41278"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU01"
FT                   /protein_id="CAR41278.1"
FT                   /translation="MLLRKARHSLKRRHMMLEVLLIVSTFFLFIIFISLLIGIKRRSSQ
FT                   MSDHQYLVYFDQVNHTIDLNDNSNLKNKVTILSENPEKGIYTIRTHLTDIKVKELLMRE
FT                   YRLTLSQVFVITEQIEHQLELV"
FT   sig_peptide     497900..498028
FT                   /locus_tag="SUB0528"
FT                   /note="Signal peptide predicted for SUB0528 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.860) with cleavage site
FT                   probability 0.600 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    497942..498010
FT                   /note="1 probable transmembrane helix predicted for SUB0528
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS             498444..498758
FT                   /transl_table=11
FT                   /locus_tag="SUB0529"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41280"
FT                   /db_xref="GOA:B9DU02"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU02"
FT                   /protein_id="CAR41280.1"
FT                   /translation="MTKALIICAGGMSSSLIAKKTQTLLAEQGVEVEMNAVGVPEGAKR
FT                   IASSEYDLYLVSPQTKMHFKQFADAGEKVGKPVVQIPPQAYIPIPMGIEKMATLVKENI
FT                   "
FT   misc_feature    498450..498749
FT                   /locus_tag="SUB0529"
FT                   /note="HMMPfam hit to PF02302, PTS system,
FT                   Lactose/Cellobiose specific IIB, score 1.6e-24"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS             498819..500786
FT                   /transl_table=11
FT                   /locus_tag="SUB0530"
FT                   /product="transcriptional regulator (antiterminator)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41281"
FT                   /db_xref="GOA:B9DU03"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU03"
FT                   /protein_id="CAR41281.1"
FT                   /translation="MLGQKEKLILQYLYLNRGNFVTSKELAEHLSCSDRTVRTYIKTLI
FT                   SFIEKKEGLEIISKQGYGYQLDLANESVYLNLISDNNIRLGTENIDINDRHNFIINQLI
FT                   FEQKEIFFDDLMDQLYVSRSTLSSDFKKIRHELARYDLKIESRANKGVYVSGAEHNKRH
FT                   FIMDYFFSGNFLKNIHQYVGDDFFKLPISFEELTIIVLDECRSQSLKLSDFVIQNLIVH
FT                   IALAISRVNDGFKISQLSIDEKKFKTEILVATNILRRVEYVTGTDFPTEEINYIALHLI
FT                   SESIHTDNSESLERISLRQDLSEAAAEIDLHYGYQFAQDFTFIEGLLKHLEVLLERVKN
FT                   NVRLDNPLLDDIQSQYKEAFVISRSLMSHLNYFKEFHLSDDEIAYVTLHLLAGIERFYQ
FT                   NNKLNALVICATGYGSAQMLRMRLENELGRQLNIVNLVGYYDITDARLEGIDLIISTID
FT                   LSNLVFSVPVFTVSVFLKDEEVQMIKDGLLHLESKHHRSQKESGSLSDQSSFTRYFSKD
FT                   RFIILEKSDKKTVLSKLVALLDDGDCEEYQVSMLDLIANRESMSTVIFDQEIAVPHPLK
FT                   AIDKEGKIGVAIVPDGVDWEEGFNAIKIIFLVSPSIYKNDGLSSMTKLMVDLTENPQAK
FT                   EAIIKSQTFDEFKNIILDMK"
FT   misc_feature    498879..498944
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1563.000, SD 4.51 at aa 21-42, sequence
FT                   VTSKELAEHLSCSDRTVRTYIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    499146..499211
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1349.000, SD 3.78 at aa 110-131, sequence
FT                   IFFDDLMDQLYVSRSTLSSDFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    499410..499667
FT                   /locus_tag="SUB0530"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 1e-07"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    499725..499997
FT                   /locus_tag="SUB0530"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 1.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   CDS             500796..501110
FT                   /transl_table=11
FT                   /locus_tag="SUB0531"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41283"
FT                   /db_xref="GOA:B9DU04"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU04"
FT                   /protein_id="CAR41283.1"
FT                   /translation="MTTDELQMAAFEIILNSGNSRTTVHEAFAAMREGNYDKAAELLES
FT                   ANEELLLAHKAQTHLLQEYAGGTEIKIEIIMVHAQDHLMTTMTLREVALEMLELYKKVQ
FT                   "
FT   misc_feature    500814..501101
FT                   /locus_tag="SUB0531"
FT                   /note="HMMPfam hit to PF02255, PTS system,
FT                   Lactose/Cellobiose specific IIA, score 1.3e-36"
FT                   /inference="protein motif:HMMPfam:PF02255"
FT   CDS             501136..501654
FT                   /transl_table=11
FT                   /locus_tag="SUB0532"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41285"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU05"
FT                   /protein_id="CAR41285.1"
FT                   /translation="MNRAEKERVETLRKTNAIKTMYYTRYFMVRYVVTFFFFVNLYWAI
FT                   MLYLSKASAVAFLPILLGAFAGFAMWEQFRMFTTEQKEAKVSKLFFKTTIAVNSCLMIL
FT                   ALTGQSHFLYPFFNESQASLIVIITLLTIGMLLSLWMLVKIYRIDANKDRQYVRINRYL
FT                   ASLKLGKHY"
FT   misc_feature    order(501211..501279,501289..501357,501418..501477,
FT                   501505..501573)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SUB0532 by TMHMM2.0 at aa 26-48, 52-74, 95-114 and 124-146"
FT   CDS             501681..503009
FT                   /transl_table=11
FT                   /locus_tag="SUB0533"
FT                   /product="sugar phosphotransferase system (PTS), IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41288"
FT                   /db_xref="GOA:B9DU06"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU06"
FT                   /protein_id="CAR41288.1"
FT                   /translation="MFELLEKYLMGPMGKVSTWRPVRAIVAAGMASIPLTIVGSAFLVL
FT                   GVLPQAFPFLAGIWAGSFDKFAALTLLAYKCSMGILTLYFALVIGYEYTKIYAEEDGIN
FT                   LDPLNGGILSVFAFFMTIPELTFTKGSMALVASETTINGWTVGGDSLARLSTSGLFTGI
FT                   LMAILAVQLYRLCVVRNWVVKMPDAVPEGVSRSFTALIPAFIVAITVILINGAFIMMGT
FT                   DIYKVIAIPFGFVKNITNSIGGIIVIYFLVHALWLVGIHGANIVMGLVNPILLANMAEN
FT                   VNGAHFAFAGEFTNAYVTVGGSGATLGVCLFMAFLAKSEQLKMLGRAAIGSSIFNINEP
FT                   LIFGLPIVYNPILAIPFITAPVVSAVLAYVVVNLNIVKEAIVQTPWPTPGGFGAFIGSG
FT                   GDIKAAILAIVCITVAFLIWLPFIKYYDNKLLAEEREVAATAA"
FT   misc_feature    order(501750..501818,501876..501944,502002..502061,
FT                   502140..502208,502266..502334,502362..502430,
FT                   502449..502517,502560..502628,502665..502724,
FT                   502734..502802,502890..502949)
FT                   /note="11 probable transmembrane helices predicted for
FT                   SUB0533 by TMHMM2.0 at aa 24-46, 66-88, 108-127, 154-176,
FT                   196-218, 228-250, 257-279, 294-316, 329-348, 352-374 and
FT                   404-423"
FT   misc_feature    501756..502763
FT                   /locus_tag="SUB0533"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.1e-65"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    502431..502463
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   CDS             503075..504163
FT                   /transl_table=11
FT                   /locus_tag="SUB0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41291"
FT                   /db_xref="GOA:B9DU07"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU07"
FT                   /protein_id="CAR41291.1"
FT                   /translation="MGKLGISIYPSKSSMSEMKAYIDLAAQYGYQRLFTSMLEVADNAQ
FT                   ETVATFTEIIQYGREKGLKTSLDVNPNLFKALNISYNQLEVFAEMGIDALRLDEGFTGY
FT                   EEAMLTHNNFGITIELNISRGQHYIDMVNDFGPNQTQLIGSHNFYPQAYTGLSFDYFLK
FT                   TAKQYKKYNLETAAFIDSPDGKIGPWPLSDRMVSAELQRDMSLTAQVSLLKMTGLIDDI
FT                   LLSSSLLSEKDLKEVADAFKQSLPVFPVKVQQELSAVEKEILLDNQHLYRGDKSDYMIR
FT                   SSQPRVIYKDHSIEPFNTIPIKRGMVTIGNNNAGQYKGELQIALKDRPNDGRQNVVAQI
FT                   SPENDILIDLLRLWQSFLFIEE"
FT   misc_feature    503081..504160
FT                   /locus_tag="SUB0534"
FT                   /note="HMMPfam hit to PF05913, Bacterial protein of unknown
FT                   function (DUF87, score 1e-133"
FT                   /inference="protein motif:HMMPfam:PF05913"
FT   CDS             complement(504224..505309)
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="SUB0535"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41293"
FT                   /db_xref="GOA:B9DU08"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU08"
FT                   /protein_id="CAR41293.1"
FT                   /translation="MTKIDHIRHFLTEEKAELAIFSDPVTVNYLTGFACDPHERQMFLF
FT                   IYEQLAPVLFVPALEVARASKIVNFPVFGYMDSENPWEKIRKVLPNTDAKTIYAEFDHL
FT                   NVTKFQGLQTVFSGRFENLTPFIQGMRLIKSADEIEKMMIAGDFADKAVKVGFDNISLE
FT                   ATETDIIAQIEFEMKKQGISKMSFDTMVLTGDNAADPHGIPGTNKIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGKPDQFKLDIYELCLEAQLKAQEFVKPGVTAAEVDAAARSVIEKA
FT                   GYGEYFNHRLGHGLGMDVHEFPSIMAGNNMIIEEGMCFSIEPGIYIPGKVGVRIEDCGH
FT                   VTKDGFQPFTKTSKELLYFEG"
FT   misc_feature    complement(504257..504892)
FT                   /gene="pepQ"
FT                   /locus_tag="SUB0535"
FT                   /note="HMMPfam hit to PF00557, metallopeptidase family M24,
FT                   score 5.4e-72"
FT                   /inference="protein motif:HMMPfam:PF00557"
FT   misc_feature    complement(504407..504445)
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00491"
FT   CDS             505481..506482
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /gene_synonym="graR"
FT                   /gene_synonym="amyR"
FT                   /gene_synonym="alsA"
FT                   /locus_tag="SUB0536"
FT                   /product="catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41295"
FT                   /db_xref="GOA:B9DU09"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU09"
FT                   /protein_id="CAR41295.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANAYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPIVLAGTVDLEHQLPSVNI
FT                   DYQAAVAEVIDILAENHKKIAFVSGPLIDDINGKVRLSGYKEGLKKNKLDYKEGLVFEA
FT                   NYSYKEGYELAQRVINSGATAAYVGEDELAAGLLNGLFAAGKSVPEDFEIITSNDSPVV
FT                   EYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKRRGTTK"
FT   misc_feature    505499..505576
FT                   /gene="ccpA"
FT                   /gene_synonym="alsA"
FT                   /gene_synonym="amyR"
FT                   /gene_synonym="graR"
FT                   /locus_tag="SUB0536"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 5e-13"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    505499..505564
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2166.000, SD 6.56 at aa 7-28, sequence
FT                   ITIYDVAREAGVSMATVSRVVN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    505505..505561
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   misc_feature    505670..506470
FT                   /gene="ccpA"
FT                   /gene_synonym="alsA"
FT                   /gene_synonym="amyR"
FT                   /gene_synonym="graR"
FT                   /locus_tag="SUB0536"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    506252..506275
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             506523..507986
FT                   /transl_table=11
FT                   /locus_tag="SUB0537"
FT                   /product="putative alpha-amylase"
FT                   /note="Similar to the C-terminal region of Bacillus
FT                   licheniformis amys alpha-amylase precursor (ec 3.2.1.1)
FT                   (1,4-alpha-d-glucan glucanohydrolase) UniProt:AMY_BACLI
FT                   (EMBL:A17930) (512 aa) fasta scores: E()=1.2e-86, 42.562%
FT                   id in 484 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41297"
FT                   /db_xref="GOA:B9DU10"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015237"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU10"
FT                   /protein_id="CAR41297.1"
FT                   /translation="MTNELMFQAFEWYLPDDHNHWKRLREAIPDFQKMGISKIWLPPAF
FT                   KGTGSNDVGYGIYDLFDLGEFDQNGTVPTKYGSKEDYLALTAALNEADIMPIADIVLNH
FT                   KANADQKETFHVLKMNPDNRQEPISEPYEIEGWTGFTFPGRQGKYNDFTWHWYHFTGLD
FT                   YDARHNETGIFLITGDNKGWANQESVDNEKGNFDYLMFNDIDFKHPEVQEHLKVWAKWF
FT                   LDTTAVKGFRLDAIKHIDANFMNNFIRYVRDHFAEDLFVFGEYWKDDSDATHHYLDEVD
FT                   MQFNLVDVALHMNFYEASHSGNAFDMTKIFESSLMQSHPDFAITFVDNHDTQSGQALQT
FT                   RVEDWFKPLAYGLILLRQEGMPCLFYGDYYGIEGDFGQMSFKDILEKLTYLRQKTVYGK
FT                   QVDYFDHANCIGWTQLGNDDSDTCLAVVMTNGDRGWKHMEVGQLYVGQTFVDYLGHCPD
FT                   EIMINEDGWADFKVEPGSISAWVPKSFLA"
FT   misc_feature    506532..507698
FT                   /locus_tag="SUB0537"
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 3e-55"
FT                   /inference="protein motif:HMMPfam:PF00128"
FT   CDS             508060..509058
FT                   /transl_table=11
FT                   /locus_tag="SUB0538"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41299"
FT                   /db_xref="GOA:B9DU11"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU11"
FT                   /protein_id="CAR41299.1"
FT                   /translation="MKVLLYLEAENFLRKSGIGRAIKHQVKALTSVGQAFTTNPKDDYD
FT                   LVHVNTYGIASWLLMTKAKKAGKKVIMHGHSTEEDFRNSFILSNQLSPMFKKYLCLFYK
FT                   KADAIITPTLYSKSLIENYGINKPVFAISNGIDLKQYGPNPQKEEAFRRYFNVKDGEKV
FT                   VMGAGLFFKRKGIDDFVKVAEKMPDVTFIWFGEMNKWMIPAEIRKIVNGNHPENVIFPG
FT                   YIKGDVYEGAMTGADAFFFPSREETEGIVVLEALASKQHVLVRDIPVYSGWVNQDSAEM
FT                   ASDIDGFVKALRKILNGQSQKTMAGYQVAESRSIEKIALELVDTYQKVMEL"
FT   misc_feature    508501..508998
FT                   /locus_tag="SUB0538"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 1.1e-12"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS             509060..510394
FT                   /transl_table=11
FT                   /locus_tag="SUB0539"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41301"
FT                   /db_xref="GOA:B9DU12"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU12"
FT                   /protein_id="CAR41301.1"
FT                   /translation="MRVGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDKNV
FT                   KRFEDPTVIRLPSVPFVSFTDRRVVYRGLISSYKIAKQYHLDIIHTQTEFSLGLLGKMV
FT                   GKALRIPVVHTYHTQYEDYVTYIANGKLIRPSMVKPILKSYLKDLDGVVCPSPIVLNLL
FT                   EDYQVKLPKRVIPTGIDLTQYIRDDISKQDIASLKEELQIADDDTFLLSLSRVSYEKNI
FT                   QAIIRQLPEVLKANPKVKLVIVGDGPYLPDLKALADQLTISENVIFTGMVPHDKVAYYY
FT                   KACDFFVSASTSETQGLTYIESLASGKPIIAHGNPYLDDLVSDKMFGTLFYHEDELADA
FT                   IIDAIIETPEMNPEMLKQKRFDISAEHFGHSMYTFYLDTIINKNKPQPQRLSLRVTGTG
FT                   KREPIKLVQTARRIPKRAFKATAVTSVKVVKAPLKMVNAIRDFLD"
FT   misc_feature    509639..510145
FT                   /locus_tag="SUB0539"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 1.9e-30"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS             510748..512694
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="SUB0540"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41303"
FT                   /db_xref="GOA:B9DU13"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DU13"
FT                   /protein_id="CAR41303.1"
FT                   /translation="MINITFPDGAVREFESGITTFDIAQSISNSLAKKALAGKFNGQLI
FT                   DTNRPIDTDGSIEIVTPDHEDAFGVLRHSAAHLFAQAAKRLFPDIHLGVGPAIAEGFYY
FT                   DTDNSSGQISNEDLPRIEAEMQKIVKENYPCIREEVTKEEALEIFKDDPYKIELINEHS
FT                   DDAAGLTIYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNAMMQRVYGTAW
FT                   FDKKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYI
FT                   TDKELASGYQHVYTPPLASVELYKTSGHWEHYQEDMFPTMDMGDGEEFVLRPMNCPHHI
FT                   QVYKNHVHSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHLFVTPEQIQEEF
FT                   QRALQLIIDVYEDFNLTDYRFRLSYRDPKDTEKYYDNDEMWENAQSMLKAALDEMGVEY
FT                   FEAEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIH
FT                   RGVISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKALRDRGIRA
FT                   DVDDRNEKMQYKIRASQTSKIPYQLIVGDKEMEDKSVNVRRYGSKATHTESLSEFMDTI
FT                   LADIARKSRPVED"
FT   misc_feature    510748..510930
FT                   /gene="thrS"
FT                   /locus_tag="SUB0540"
FT                   /note="HMMPfam hit to PF02824, TGS domain, score 1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF02824"
FT   misc_feature    511531..511998
FT                   /gene="thrS"
FT                   /locus_tag="SUB0540"
FT                   /note="HMMPfam hit to PF00587, tRNA synthetase class II
FT                   core domain (, score 4.7e-49"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    512386..512661
FT                   /gene="thrS"
FT                   /locus_tag="SUB0540"
FT                   /note="HMMPfam hit to PF03129, Anticodon binding domain,
FT                   score 4.2e-31"
FT                   /inference="protein motif:HMMPfam:PF03129"
FT   CDS             complement(512730..513719)
FT                   /transl_table=11
FT                   /locus_tag="SUB0541"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41305"
FT                   /db_xref="GOA:B9DU14"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU14"
FT                   /protein_id="CAR41305.1"
FT                   /translation="MITIQNHKQQMIPQYIKGMLDIHSHLEKVPDFPIIYNRHHDPEKV
FT                   PILSGGGSGHEPAHIGFVGDGMLTAAVYGDLFTPPTYDHILEAIRFLDKGKGVYVIIKN
FT                   FDADIREFSKAITLARKECIQVKYIVSHDDISVEPQKNFQMRHRGLAGTILLHKILGQA
FT                   AQNGVSLEQLEKIAFDLATEIATIGFATKSARFPNAALPLFDLPEDHISFGIGIHGEEG
FT                   YRTVPFSSSEHLAVEIINKLQIKFHWQEREDFILLVNNLGTATDLEQGIFLNDICQLLD
FT                   LEGLNIHFIKNGKYMTSLDMSGISVTLARLKDPAWLDYLKAPTNAFAW"
FT   misc_feature    complement(512733..513674)
FT                   /locus_tag="SUB0541"
FT                   /note="HMMPfam hit to PF02733, Dak1 domain, score 9.2e-59"
FT                   /inference="protein motif:HMMPfam:PF02733"
FT   CDS             complement(513728..514267)
FT                   /transl_table=11
FT                   /locus_tag="SUB0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41307"
FT                   /db_xref="GOA:B9DU15"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU15"
FT                   /protein_id="CAR41307.1"
FT                   /translation="MATSLITKKRIAKAFKKQLEKKPIEKISVVDIMDQAGIRRQTFYN
FT                   YFVDKFELLDWIFETELQEQVTNNLNYISGFKLLEELLFYFSLNKSFYAQLFSIRDQND
FT                   FYSYFGDYCLVLMEKIISEHEHNYHLELSPQYRQFLKTYHSRALADMIRAFVSQNNYHP
FT                   DLTMIKKIILASFEDI"
FT   CDS             514418..515407
FT                   /transl_table=11
FT                   /locus_tag="SUB0543"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41308"
FT                   /db_xref="GOA:B9DU16"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU16"
FT                   /protein_id="CAR41308.1"
FT                   /translation="MKKIMNNPGQIVDDMLQGLSYMHGDLVERLDGYDVIVRKAAKDGK
FT                   VAIISGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQILEAIKAADEGAGVFMVIK
FT                   NYSGDIMNFEMAQELAEMEGIAISSVVVDDDIAVENSLYTQGKRGVAGTILVHKILGYA
FT                   AHQGKSLEEIKAIADALVPQIKTIGLALTGATVPEVGKPGFVLADDEFEYGVGIHGEPG
FT                   YKKEKMKASKELAAELVGKLDQEFQMEAGQSYALLINGLGGTPLMEQYVFANDVAQLLE
FT                   EKNITVAYKKIGNYMTSIEMAGLSLTLLKLENQQWLEALQANVITPAW"
FT   misc_feature    514463..515404
FT                   /locus_tag="SUB0543"
FT                   /note="HMMPfam hit to PF02733, Dak1 domain, score 8.5e-108"
FT                   /inference="protein motif:HMMPfam:PF02733"
FT   CDS             515417..515992
FT                   /transl_table=11
FT                   /locus_tag="SUB0544"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41309"
FT                   /db_xref="GOA:B9DU17"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU17"
FT                   /protein_id="CAR41309.1"
FT                   /translation="MDIQHVEKWMRLFNDKIKEHKDYLSELDTPIGDGDHGGNMARGMA
FT                   AVIAAMEEKTFDSTADLFKMVSLQLISKVGGASGPLYGSAFMGMAKVAQTSSSSEILSE
FT                   GLAMIQKRGKAEKGEKTMVDVWIPVIEALGQGQLEKETIWDAVKATEPLVATKGRASYV
FT                   GDRSKGHIDPGSYSSGLLFEAMLEAEVV"
FT   misc_feature    515504..515977
FT                   /locus_tag="SUB0544"
FT                   /note="HMMPfam hit to PF02734, DAK2 domain, score 5.1e-69"
FT                   /inference="protein motif:HMMPfam:PF02734"
FT   CDS             515992..516366
FT                   /transl_table=11
FT                   /locus_tag="SUB0545"
FT                   /product="sugar phosphotransferase system (PTS), IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41310"
FT                   /db_xref="GOA:B9DU18"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU18"
FT                   /protein_id="CAR41310.1"
FT                   /translation="MSELGILIVSHSKHIAQGVYDLVQEVAKDVSITFVGGDPDGGIGT
FT                   SFDQVQQIVDDNPKEKLLAFFDLGSARMNLEMVADFSDKEIHIVQVPIVEGTYTAAALI
FT                   QAGLDQDGILAQLTELEINK"
FT   misc_feature    516001..516333
FT                   /locus_tag="SUB0545"
FT                   /note="HMMPfam hit to PF03610, PTS system fructose IIA
FT                   component, score 9.7e-36"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS             516377..517090
FT                   /transl_table=11
FT                   /gene="glpF2"
FT                   /locus_tag="SUB0546"
FT                   /product="glycerol uptake facilitator protein 2"
FT                   /note="Similar to SUB1431, 56.466% identity (56.466%
FT                   ungapped) in 232 aa overlap (1-232:1-232)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41312"
FT                   /db_xref="GOA:B9DU19"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU19"
FT                   /protein_id="CAR41312.1"
FT                   /translation="MSFIGEFLGTLILVLLGDGVVSAVCLKKTKAEASGWIAIVLGWGL
FT                   AVAVAVYITGFMSGAHLNPAVTLAMAATGALSWGQVPVYLIAQMLGAMVGALLVYLHYF
FT                   PHWQETKDSATVLACFSTGPAIRHTWSNFLGEALGTAVLVITVMAIGPNKVAQGFGPLI
FT                   VGLVVMAVGFSLGGTTGYAINPARDLGPRIMHSILPIPNKSDSDWSYAWIPVVAPIVGG
FT                   VVGALIFQMVLNTMA"
FT   misc_feature    516377..517063
FT                   /gene="glpF2"
FT                   /locus_tag="SUB0546"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic protein,
FT                   score 3.3e-60"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    order(516386..516454,516491..516559,516617..516685,
FT                   516764..516832,516860..516928,517007..517075)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SUB0546 by TMHMM2.0 at aa 4-26, 39-61, 81-103, 130-152,
FT                   162-184 and 211-233"
FT   misc_feature    516557..516583
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS             517199..518206
FT                   /transl_table=11
FT                   /locus_tag="SUB0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41313"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU20"
FT                   /protein_id="CAR41313.1"
FT                   /translation="MTLEKRYKTLRNLSLLGWRKEELALFSDQKMIDDRIGSPVFLRFW
FT                   KKAQKTYPGKVLLKIILDMSKMPLELSGELSETQALLKRFHPDLSPDASFWPEFAALVN
FT                   QTFPERTLGKEGALEKRLHQFRYLISSQQAQYIRDHFGKGQKKDSQALADFLRAKKGPT
FT                   FWRKAVDYSLSESSRLHNKLKIEDNRVQFPDNDISYNIKLLMGFHTEFILDDKGKFLNE
FT                   LDAEKMTEKGVVNGASFNYGTAGQRHWDLDVDPIRKHDPQFRRLVARGYRSPKHIVKKW
FT                   YQRQLDDFEHSYFNKKGIFGYGGKSSYHYVKKQSWRYKWFIRYLKLLSFFKKYR"
FT   CDS             complement(518237..518884)
FT                   /transl_table=11
FT                   /locus_tag="SUB0548"
FT                   /product="putative amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41315"
FT                   /db_xref="GOA:B9DU21"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:B9DU21"
FT                   /protein_id="CAR41315.1"
FT                   /translation="MAQLFTPSNLSFILEGLGLTLYISLISIVLSTIFGTFLAIMRNGK
FT                   NTFLKLVASIYIEFVRNVPNLLWIFIIFLVFQMKSTPAGITAFTVFTSAALAEIIRGGL
FT                   NGVDAGQTEAGLAQGFSASQVFLLIVFPQAYRKMLPAIISQFVTVIKDTSLLYSVIAIQ
FT                   ELFGKSQILMGKYFQAEQVFALYALITFIYFVINFIISSLSRRLAKKWAQAN"
FT   misc_feature    complement(518246..518848)
FT                   /locus_tag="SUB0548"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.4e-24"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(order(518273..518341,518621..518689,
FT                   518765..518833))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SUB0548 by TMHMM2.0 at aa 18-40, 66-88 and 182-204"
FT   misc_feature    complement(518489..518575)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             complement(518900..519601)
FT                   /transl_table=11
FT                   /locus_tag="SUB0549"
FT                   /product="putative amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41316"
FT                   /db_xref="GOA:B9DRG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG5"
FT                   /protein_id="CAR41316.1"
FT                   /translation="MILLAVDSPFALSKWQAFFSHFDLFIKAFLYTLGMSFLALLLALV
FT                   LGILFGAMSTSKHKTLKAIARVYVELYQNTPLLVQFVFVYYGLAIISNGLIMISTFFTA
FT                   VLCVGIYHGAYIAEVIRSGIEAVPKGQIEAALSQGFTYEQTMSLIVLPQAVRTILPPMT
FT                   NQVVNLIKNTSVVAIISGADIMFTAKAWAYETTNYVPAFAGAAILYFILCYPLANWARR
FT                   KEEANKKTYSV"
FT   misc_feature    complement(518915..519517)
FT                   /locus_tag="SUB0549"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6e-24"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(order(518942..519010,519038..519106,
FT                   519254..519322,519332..519391,519452..519520))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SUB0549 by TMHMM2.0 at aa 28-50, 71-90, 94-116, 166-188 and
FT                   198-220"
FT   misc_feature    complement(519146..519232)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             complement(519616..520431)
FT                   /transl_table=11
FT                   /locus_tag="SUB0550"
FT                   /product="putative glutamine-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41318"
FT                   /db_xref="GOA:B9DRG6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG6"
FT                   /protein_id="CAR41318.1"
FT                   /translation="MNQFKKWTFFCLMTLLTLIFMPKASADDNQLLKTKSIQTIKKAGV
FT                   LRVGVKQDVPNFGYYSADTGKYEGMEVDLARKIAKKLKVKPVFTAVTAQTREALLDNGQ
FT                   LDIIIATYTITPERQANYSFSIPYYRDEVGFLVNQSEKIDSIKDLNHRTIGVAQGSTTK
FT                   AAIEEYGKAHHLDFKFVQLGSYPELAISLYSKRIQAFSVDKSILSGYVSKQTAILPDGF
FT                   NQQSYGIASSKANSQLTKYINQLIEEWTNDGSLQAIYKNYGLKPAKSEK"
FT   misc_feature    complement(519637..520296)
FT                   /locus_tag="SUB0550"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 1.1e-63"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   sig_peptide     complement(520354..520431)
FT                   /locus_tag="SUB0550"
FT                   /note="Signal peptide predicted for SUB0550 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(520445..521224)
FT                   /transl_table=11
FT                   /gene="glnQ4"
FT                   /locus_tag="SUB0551"
FT                   /product="putative glutamine transporter, ATP-binding
FT                   protein 4"
FT                   /note="Similar to SUB1278, 53.719% identity (54.167%
FT                   ungapped) in 242 aa overlap (3-244:5-244); and SUB1153,
FT                   51.653% identity (52.083% ungapped) in 242 aa overlap
FT                   (4-245:6-245)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41320"
FT                   /db_xref="GOA:B9DRG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG7"
FT                   /protein_id="CAR41320.1"
FT                   /translation="MALIEFKNVEKYYGSYHALKNINLSIEKGQVVVLLGPSGSGKSTL
FT                   IRTINALEKIETGSLKVNNKEIVNASAKELVALRKEVGMVFQHFNLYPHKTVLENVTLA
FT                   PIKVLGMSKSEAEKVAEKYLTFVNMWDRKDSYPSMLSGGQKQRIAIARGLAMNPEILLF
FT                   DEPTSALDPETIGDVLAVMQNLAADGMNMIVVTHEMGFAREVADRIIFMADGEILEDTT
FT                   DVTGFFDHPKEPRAQQFLSKIINHTSEKVQAKKKIRH"
FT   misc_feature    complement(520580..521140)
FT                   /gene="glnQ4"
FT                   /locus_tag="SUB0551"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.4e-70"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(520763..520807)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(521096..521119)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             521479..522189
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /gene_synonym="covR"
FT                   /locus_tag="SUB0552"
FT                   /product="response regulator protein"
FT                   /note="Similar to SUB0567, 50.847% identity (52.402%
FT                   ungapped) in 236 aa overlap (1-233:1-232)"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41322"
FT                   /db_xref="GOA:B9DRG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG8"
FT                   /protein_id="CAR41322.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGKEAVLAFEEEK
FT                   PDLVILDLMLPEMDGLEVAKEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIESAVAEENASAGSQELTIGNLQILPDAFLAKKYGKEVELTH
FT                   REFELLHHLANHIGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSHD"
FT   misc_feature    521482..521838
FT                   /gene="vicR"
FT                   /gene_synonym="covR"
FT                   /locus_tag="SUB0552"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.7e-44"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    521944..522174
FT                   /gene="vicR"
FT                   /gene_synonym="covR"
FT                   /locus_tag="SUB0552"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 9.2e-24"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   CDS             522182..523540
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /gene_synonym="covS"
FT                   /locus_tag="SUB0553"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41324"
FT                   /db_xref="GOA:B9DRG9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRG9"
FT                   /protein_id="CAR41324.1"
FT                   /translation="MTENLIGNLSLFELSILLLLIFVAAYFIYLAVRDYRNAKIIRQMS
FT                   HKIRDLINGRYTDEINEKADIELIELSEQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRTGQIMMINETAQKQLNISKEEALLMNITDLLGQDTPYTYRELVSKTPIVTL
FT                   NRRDETGEFITLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGALKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTALAVE
FT                   MTNFTAFMTSILNRFDLVRNQNTVSGKSYEIIRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKIRVKMKTTDSQLIISISDQGLGIPKKDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIVKQHNGFIWAKSDYGKGSTFTIVLPYEKDVVAGTDDEWEDDID"
FT   misc_feature    522209..522277
FT                   /note="1 probable transmembrane helix predicted for SUB0553
FT                   by TMHMM2.0 at aa 10-32"
FT   misc_feature    522461..522649
FT                   /gene="vicK"
FT                   /gene_synonym="covS"
FT                   /locus_tag="SUB0553"
FT                   /note="HMMPfam hit to PF00989, PAS domain, score 1.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00989"
FT   misc_feature    522803..523003
FT                   /gene="vicK"
FT                   /gene_synonym="covS"
FT                   /locus_tag="SUB0553"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 8.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    523154..523489
FT                   /gene="vicK"
FT                   /gene_synonym="covS"
FT                   /locus_tag="SUB0553"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 4.9e-45"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             523544..524353
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="SUB0554"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41326"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRH0"
FT                   /protein_id="CAR41326.1"
FT                   /translation="MEIEGFNYSILASGSTGNSFYLETPKKKILVDAGLTGKKITSLLA
FT                   EIDRKPEDLDAIFITHEHSDHIKGVGVLARKYHLDVYANEKTWQILDDRNMIGKIDVSQ
FT                   KHVFERDKMITFGDIDIESFGVSHDAYDPQFYRFMKDNKSFVMLTDTGYVSDRMSGIIE
FT                   NADAYLIESNHDIEILRSGSYPWSLKQRILSDKGHLSNEDGAGAMIRSMGNKTKKIYLG
FT                   HLSKENNIKELAHMTMENQLAKADLPVGSAFKVLDTSPDSACPLTSI"
FT   misc_feature    523589..524137
FT                   /gene="vicX"
FT                   /locus_tag="SUB0554"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 2.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS             524512..525204
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /gene_synonym="acpA"
FT                   /locus_tag="SUB0555"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41327"
FT                   /db_xref="GOA:B9DRH1"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9DRH1"
FT                   /protein_id="CAR41327.1"
FT                   /translation="MKNLEALLKSSFAIEFEDKTLLETAFTHTSYANEHRLLNISHNER
FT                   LEFLGDAVLQLIISEYLFKKYPHKAEGELSKQRSMIVREESLASFSRHCAFEPYIKLGK
FT                   GEEKSGGRNRDTILGDLFEAFLGALLLDKGVEEVRRFLNQVMIPQVEKGNFEKVNDYKT
FT                   SLQEILQAKGDTIIDYKVINESGPAHAKQFEVVVLANQVELSKGIGRSKKLAEQNAAEN
FT                   ALKALSEE"
FT   misc_feature    524641..524913
FT                   /gene="rnc"
FT                   /gene_synonym="acpA"
FT                   /locus_tag="SUB0555"
FT                   /note="HMMPfam hit to PF00636, RNase3 domain, score
FT                   1.1e-41"
FT                   /inference="protein motif:HMMPfam:PF00636"
FT   misc_feature    524641..524667
FT                   /note="PS00517 Ribonuclease III family signature."
FT                   /inference="protein motif:Prosite:PS00517"
FT   misc_feature    524992..525192
FT                   /gene="rnc"
FT                   /gene_synonym="acpA"
FT                   /locus_tag="SUB0555"
FT                   /note="HMMPfam hit to PF00035, Double-stranded RNA binding
FT                   motif, score 3.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00035"
FT   CDS             525205..528750
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SUB0556"
FT                   /product="putative chromosome partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:SUB0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAR41328"
FT                   /db_xref="GOA:B9DRH2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9DRH2"
FT                   /protein_id="CAR41328.1"
FT                   /translation="MYLKTIEMQGFKSFADKTKIEFEKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKSLRGGKMPDIIFAGTESRNALNFAEVAIVLDNSDAFIKDAPKEIRVERHI
FT                   YRNGDSDYIIDGKKVRLRDVHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRTIFEE
FT                   AAGVLKYKTRKKETQSKLTQTQDNLDRLEDIIFELDNQVKPLEKQAEIAKKFLHLDADR
FT                   KQLQLDILVEDVQQDQKSMAEKEEDLGQLKENLRVYYEHRDSLEKENQSLKHLRQELVR
FT                   QLDDHQATLLDLTNLSADLKRQIDRIQLETHQKNEKEAEAKVQLENLSQDWERLQEQIQ
FT                   EKRNTITSLESQHSSLSEEIDNLKNELQRYSNDPDQLIESLREEFVSLMQKEADYSNQL
FT                   TLLISDMEKESQERASNAQEREEMLAKVQHLKADFQTVQSDYDVKQLAVRQLLEAYQKL
FT                   EGQIAKQEVTYQAEQSQLFDLYDQKKAKEARLASLESIQKNHSQFYAGVKSVLQAAQTI
FT                   GGILGAVSEHLSFDSQYQTALEIALGPSSQHIIVKDEVAAKSAISFLKQNRQGRATFLP
FT                   LTTIKPRFLSDNQLHQVQQYQGFLGTAESLVSYDHRFKTIFQNLLNTTLIFDTVDHANL
FT                   AAKALQYKVRIITLDGTELRPGGSFSGGSNRQNNTTFIKPEMDLIQKELSRLEGQLKEK
FT                   ETLVSDLKLVLKEEKEKLQDLKGKGEEARFAEQKAELHYQQLKETLADSEEILRLMIEQ
FT                   TDKSSLNDFETQKEELQNQLSQLETDKNQLSQQIDEIKGNKNLINEKKSELTNQLSQLQ
FT                   LKERDVTNQSRFEKTDLSRLESDAEACRLNIDKLSQLLQNPVSQEEMDRLPLLEKQLQD
FT                   VESKKADVEQKRIQLRFKSEDCQAQLEDLEEQLSKEQAKNEDFIRQQTKLEAEMDYLKD
FT                   RLRTFAKTLSEDFQMSFEEAKEMANPIQSMISEKQRLKQLLKTIKALGPINLDAISQFD
FT                   EVSERLEFLNSQKFDLNKAKNLLLDTINSMDNEVKARFKVTFEAIRESFQETFKQMFGG
FT                   GSADLVLTEGDLLSAGVEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDYLNRFDKNSQFIVVTHRKGTMAAADSIYGITMQESGVSKV
FT                   VSVKLKDSVDLAFLN"
FT   misc_feature    525205..525705
FT                   /gene="smc"
FT                   /locus_tag="SUB0556"
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 1.6e-71"
FT                   /inference="protein motif:HMMPfam:PF02463"
FT   misc_feature    525295..525318
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    526753..527196
FT                   /gene="smc"
FT                   /locus_tag="SUB0556"
FT                   /note="HMMPfam hit to PF06470, SMC proteins Flexible Hinge
FT                   Domain, score 1.6e-36"
FT                   /inference="protein motif:HMMPfam:PF06470"
FT   misc_feature    528112..528717
FT                   /gene="smc"
FT                   /locus_tag="SUB0556"
FT                   /note="HMMPfam hit to PF02483, SMC family, C-terminal
FT                   domain, score