spacer

EBI Dbfetch

ID   AM944568; SV 1; linear; genomic DNA; STD; HUM; 3030 BP.
XX
AC   AM944568;
XX
DT   12-MAR-2008 (Rel. 95, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens, HLA-A gene for MHC class I antigen, HLA-A*290201 allele, exon
DE   1-8
XX
KW   HLA-A gene; HLA-A*290201 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3030
RA   Tran H.;
RT   ;
RL   Submitted (29-FEB-2008) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01100.x.
RX   PUBMED; 18647362.
RA   Heinold A., Schaller-Suefling E., Opelz G., Scherer S., Tran T.H.;
RT   "Identification of two novel HLA alleles, HLA-A*02010103 and HLA-B*4455,
RT   and characterization of the complete genomic sequence of HLA-A*290201";
RL   Tissue Antigens 72(4):397-400(2008).
XX
DR   MD5; 5e0480d3165d09cc32ab30c58deb1b16.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
DR   Ensembl-Tr; ENST00000550728; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3030
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="peripheral blood"
FT                   /cell_type="leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(109..181,311..580,822..1097,1698..1973,2073..2189,
FT                   2630..2662,2805..2852,3022..3026)
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B0UXQ0"
FT                   /db_xref="IMGT/HLA:A*29:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0UXQ0"
FT                   /protein_id="CAQ16345.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            109..181
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=1
FT   intron          182..310
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=1
FT   exon            311..580
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=2
FT   intron          581..821
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=2
FT   exon            822..1097
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=3
FT   intron          1098..1697
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=3
FT   exon            1698..1973
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=4
FT   intron          1974..2072
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=4
FT   exon            2073..2189
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=5
FT   intron          2190..2629
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=5
FT   exon            2630..2662
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=6
FT   intron          2663..2804
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=6
FT   exon            2805..2852
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=7
FT   intron          2853..3021
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=7
FT   exon            3022..3026
FT                   /gene="HLA-A"
FT                   /allele="A*290201"
FT                   /number=8
XX
SQ   Sequence 3030 BP; 577 A; 868 C; 946 G; 639 T; 0 other;
     ctcccattgg gtgtcgggtt tccagagaag ccaatcagtg tcgtcgcggt cgcggttcta        60
     aagtccgcac gcacccaccg ggactcagat tctccccaga cgccgaggat ggccgtcatg       120
     gcgccccgaa ccctcctcct gctactcttg ggggccctgg ccctgaccca gacctgggcg       180
     ggtgagtgcg gggtcgtggg gaaaccgcct ctgcggggag aagcaagggg cccgcccggc       240
     ggggacgcag gacccgggta gccgcgccgg gaggagggtc gggtgggtct cagccactcc       300
     tcgcccccag gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc       360
     ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac       420
     agcgacgccg cgagccagag gatggagccg cgggcaccgt ggatagagca ggaggggccg       480
     gagtattggg acctgcagac acggaatgtg aaggcccagt cacagactga ccgagcgaac       540
     ctggggaccc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       600
     gcgcaggtca cgacctctca tcccccacgg acgggccggg tcgcccacag tctccgggtc       660
     cgagatccac cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc       720
     ctttacccgg tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccgga       780
     cggggctcgg gggactgggc tgaccgtggg gtcggggcca ggttctcaca ccatccagat       840
     gatgtatggc tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc ggcaggacgc       900
     ctacgacggc aaggattaca tcgccttgaa cgaggacctg cgctcttgga ccgcggcgga       960
     catggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag      1020
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1080
     gacgctgcag cgcacgggta ccgggggcca cggggcgcct ccctgatcgc ctgtagatct      1140
     cccgggctgg cctcccacaa ggaggggaga caattgggac caacactaga atatcgccct      1200
     ccctctggtc ctgagggaga ggaatcctcc tgggtttcca gatcctgtac cagagagtga      1260
     ctctgaggtt ccgccctgct ctctgacaca attaagggat aaaatctctg aaggaatgac      1320
     gggaagacga tccctcgaat actgatgagt ggttcccttt gacacacacc ggcagcagcc      1380
     ttgggcccgt gacttttcct ctcaggcctt gttctctgct tcacactcaa tgtgtgtggg      1440
     ggtctgagtc cagcacttct gagtccctca gcctccactc aggtcaggac cagaagtcgc      1500
     tgttccctct tcagggacta gaattttcca cggaatagga gattatccca ggtgcctgtg      1560
     tccaggctgg tgtctgggtt ctgtgctccc ttccccatcc caggtgtcct gtccattctc      1620
     aagatagcca catgtgtgct ggaggagtgt cccatgacag atgcaaaatg cctgaatgtt      1680
     ctgactcttc ctgacagacg cccccaagac gcatatgact caccacgctg tctctgacca      1740
     tgaggccacc ctgaggtgct gggccctgag cttctaccct gcggagatca cactgacctg      1800
     gcagcgggat ggggaggacc agacccagga cacggagctt gtggagacca ggcctgcagg      1860
     ggatggaacc ttccagaagt gggcgtctgt ggtggtgcct tctggacagg agcagagata      1920
     cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat ggggtaagga      1980
     gggagatggg ggtgtcatgt cttttaggga aagcaggagc ctctctgacc tttagcaggg      2040
     tcagggcccc tcaccttccc ctcttttccc agagccgtct tcccagccca ccatccccat      2100
     cgtgggcatc attgctggcc tagttctctt tggagctgtg ttcgctggag ctgtggtcgc      2160
     tgctgtgagg tggaggagga agagctcagg tggggtgaag ggatgaaggg tgggtctgag      2220
     atttcttgtc tcactgaggg ttccaagacc caggtagaag tgtgccctgc ctcgttactg      2280
     ggaagcacca tccacaatta tgggcctacc cagcctgggc cctgtgtgcc agcacttact      2340
     cttttgtaaa gcacctgtta aaatgaagga cagatttatc accttgatta cggcggtgat      2400
     gggacctgat cccagcagtc acaagtcaca ggggaaggtc cctgaggacc ttcaggaggg      2460
     cggttggtcc aggacccaca cctgctttct tcatgtttcc tgatcccgcc ctgggtctgc      2520
     agtcacacat ttctggaaac ttctctgagg tccaagactt ggaggttcct ctaggacctt      2580
     aaggccctgg ctcctttctg gtatctcaca ggacattttc ttcccacaga tagaaaagga      2640
     gggagctact ctcaggctgc aagtaagtat gaaggaggct gatgcctgag gtccttggga      2700
     tattgtgttt gggagcccgt gggggagctc acccacccca caattcctcc tctagccaca      2760
     tcttctgtgg gatctgacca ggttctgttt ttgtcctacc ccaggcagtg acagtgccca      2820
     gggctctgat atgtctctca cagcttgtaa aggtgagagc ctggagggcc tgatgtgtgt      2880
     tgggtgttgg gcggaacagt ggacgcagct gtgctatggg gtttctttgc attggatgta      2940
     ttgagcatgc gatgggctgt ttaaagtgtg actcctcact gtgacagata cgaatttgtt      3000
     catgaatatt tttttctata gtgtgagaca                                       3030
//


spacer
spacer