Dbfetch

ID   AM944346; SV 1; linear; genomic DNA; STD; HUM; 1016 BP.
XX
AC   AM944346;
XX
DT   05-MAR-2008 (Rel. 95, Created)
DT   11-MAR-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*03new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1016
RA   Witter K.;
RT   ;
RL   Submitted (29-FEB-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Lochmann E.;
RT   "Retrospective Sequence-based HLA-typing of an Italian bone marrow
RT   recipient and his donor revealed a mismatch in HLA-DQB1 caused by a novel
RT   allele, HLA- DQB1*03new";
RL   Unpublished.
XX
DR   MD5; dc33dd87b713daa0dc4948f70eb7243e.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1016
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<84..353,735..>1016)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAQ16179.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVQWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQNPITVEW"
FT   exon            84..353
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=2
FT   intron          354..734
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=2
FT   exon            735..1016
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=3
FT   variation       840
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /replace="g"
FT                   /compare=AY656682.1
XX
SQ   Sequence 1016 BP; 149 A; 236 C; 247 G; 138 T; 246 other;
     gggccgggtc agggcggcgg ctgcggggtg gccgggctgg ggccgggccg gggccggact        60
     gaccggccgg tgattccccg cagaggattt cgtgtaccag tttaaggcca tgtgctactt       120
     caccaacggg acggagcgcg tgcgttatgt gaccagatac atctataacc gagaggagta       180
     cgcacgcttc gacagcgacg tggaggtgta ccgggcggtg acgccgctgg ggccgcctga       240
     cgccgagtac tggaacagcc agaaggaagt cctggagagg acccgggcgg agttggacac       300
     ggtgtgcaga cacaactacc agttggagct ccgcacgacc ttgcagcggc gaggtgagcg       360
     tcgtcgcccc gctgcgaggc ccactcttgg ccggggcccc gagtctctgc gctaggaggg       420
     acgagggggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnncgtgc tgtgtggtct cacatctcac tcctatatct ttccctgtct       720
     gttactgccc tcagtggagc ccacagtgac catctcccca tccaggacag aggccctcaa       780
     ccaccacaac ctgctggtct gctcagtgac agatttctat ccagcccaga tcaaagtcca       840
     gtggtttcgg aatgaccagg aggagacaac cggcgttgtg tccacccccc ttattaggaa       900
     cggtgactgg accttccaga tcctggtgat gctggaaatg actccccagc atggagacgt       960
     ctacacctgc cacgtggagc accccagcct ccagaacccc atcaccgtgg agtggc          1016
//