spacer

EBI Dbfetch

ID   AM944063; SV 1; linear; genomic DNA; STD; HUM; 1257 BP.
XX
AC   AM944063;
XX
DT   01-APR-2008 (Rel. 95, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 3)
XX
DE   Homo sapiens partial MIC gene for MHC class-I chain related protein A,
DE   MICA*019variant allele, exons 2-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1257
RA   Cox S.T.;
RT   ;
RL   Submitted (29-FEB-2008) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01173.x.
RX   PUBMED; 19140841.
RA   Cox S.T., Stephens H.A.F., Fernando R., Grant J., Madrigal J.A.,
RA   Little A.-.M.;
RT   "Two novel MICA alleles, MICA*054 and MICA*056";
RL   Tissue Antigens 73(1):85-87(2009).
XX
DR   MD5; 1bd19e405da55c2e30b6633def2b9366.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AM944063.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..256,357..643,744..1023,1124..>1257)
FT                   /codon_start=3
FT                   /gene="MIC"
FT                   /allele="MIC*019variant"
FT                   /product="MHC class-I chain related protein A"
FT                   /function="ligand for NKG2D"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*056"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /protein_id="CAQ16171.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQSGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            <1..256
FT                   /gene="MIC"
FT                   /allele="MIC*019variant"
FT                   /number=2
FT   gap             257..356
FT                   /estimated_length=unknown
FT   exon            357..643
FT                   /gene="MIC"
FT                   /allele="MIC*019variant"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1023
FT                   /gene="MIC"
FT                   /allele="MIC*019variant"
FT                   /number=4
FT   variation       888
FT                   /replace="g"
FT                   /compare=AJ250804.1
FT   gap             1024..1123
FT                   /estimated_length=unknown
FT   exon            1124..>1257
FT                   /gene="MIC"
FT                   /allele="MIC*019variant"
FT                   /number=5
XX
SQ   Sequence 1257 BP; 242 A; 245 C; 266 G; 204 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtcgg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc gaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct atttttgtta      1200
     ttattatttt ctatgtccgt tgttgtaaga agaaaacatc agctgcagag ggtccag         1257
//


spacer
spacer