Dbfetch

ID   AM943368; SV 1; linear; genomic DNA; STD; HUM; 3023 BP.
XX
AC   AM943368;
XX
DT   26-FEB-2008 (Rel. 94, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*020101XX allele,
DE   exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3023
RA   Tran H.;
RT   ;
RL   Submitted (22-FEB-2008) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01100.x.
RX   PUBMED; 18647362.
RA   Heinold A., Schaller-Suefling E., Opelz G., Scherer S., Tran T.H.;
RT   "Identification of two novel HLA alleles, HLA-A*02010103 and HLA-B*4455,
RT   and characterization of the complete genomic sequence of HLA-A*290201";
RL   Tissue Antigens 72(4):397-400(2008).
XX
DR   MD5; 0ac19a55ed1a22389a2d667c42ba1218.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3023
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="peripheral blood"
FT                   /cell_type="leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(101..173,304..573,815..1090,1691..1966,2066..2182,
FT                   2621..2653,2796..2843,3013..3017)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q53Z42"
FT                   /db_xref="IMGT/HLA:A*02:01:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q53Z42"
FT                   /protein_id="CAQ15739.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     101..173
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT   exon            101..173
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=1
FT   intron          174..303
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=1
FT   mat_peptide     join(304..573,815..1090,1691..1966,2066..2182,2621..2653,
FT                   2796..2843,3013..3014)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /product="HLA-A2 antigen"
FT   exon            304..573
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=2
FT   intron          574..814
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=2
FT   exon            815..1090
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=3
FT   intron          1091..1690
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=3
FT   exon            1691..1966
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=4
FT   intron          1967..2065
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=4
FT   exon            2066..2182
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=5
FT   intron          2183..2620
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=5
FT   exon            2621..2653
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=6
FT   intron          2654..2795
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=6
FT   exon            2796..2843
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=7
FT   intron          2844..3012
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=7
FT   exon            3013..3017
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020101XX"
FT                   /number=8
XX
SQ   Sequence 3023 BP; 590 A; 863 C; 940 G; 630 T; 0 other;
     gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg gtcgcggttc taaagtccgc        60
     acgcacccac cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg       120
     aaccctcgtc ctgctactct cgggggctct ggccctgacc cagacctggg cgggtgagtg       180
     cggggtcggg agggaaacgg cctctgcggg gagaagcaag gggcccgcct ggcgggggcg       240
     caagacccgg gaagccgcgc cgggaggagg gtcgggcggg tctcagccac tcctcgtccc       300
     caggctctca ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc       360
     cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       420
     ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt ccggagtatt       480
     gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg gacctgggga       540
     ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       600
     tcacgacctc tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc       660
     cgccccgaag ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgcctttacc       720
     cggtttcatt ttcagtttag gccaaaaatc cccccaggtt ggtcggggcg gggcggggct       780
     cgggggaccg ggctgaccgc ggggtccggg ccaggttctc acaccgtcca gaggatgtat       840
     ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt accaccagta cgcctacgac       900
     ggcaaggatt acatcgccct gaaagaggac ctgcgctctt ggaccgcggc ggacatggca       960
     gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg cggagcagtt gagagcctac      1020
     ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg      1080
     cagcgcacgg gtaccagggg ccacggggcg cctccctgat cgcctgtaga tctcccgggc      1140
     tggcctccca caaggagggg agacaattgg gaccaacact agaatatcgc cctccctctg      1200
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag      1260
     gttccgccct gctctctgac acaattaagg gataaaatct ctgaaggaat gacgggaaga      1320
     cgatccctcg aatactgatg agtggttccc tttgacacac acaggcagca gccttgggcc      1380
     cgtgactttt cctctcaggc cttgttctct gcttcacact caatgtgtgt gggggtctga      1440
     gtccagcact tctgagtcct tcagcctcca ctcaggtcag gaccagaagt cgctgttccc      1500
     tcttcaggga ctagaatttt ccacggaata ggagattatc ccaggtgcct gtgtccaggc      1560
     tggtgtctgg gttctgtgct cccttcccca tcccaggtgt cctgtccatt ctcaagatag      1620
     ccacatgtgt gctggaggag tgtcccatga cagatgcaaa atgcctgaat gatctgactc      1680
     ttcctgacag acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc      1740
     accctgaggt gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg      1800
     gatggggagg accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga      1860
     accttccaga agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc      1920
     catgtgcagc atgagggttt gcccaagccc ctcaccctga gatggggtaa ggagggagac      1980
     gggggtgtca tgtcttttag ggaaagcagg agcctctctg acctttagca gggtcagggc      2040
     ccctcacctt cccctctttt cccagagccg tcttcccagc ccaccatccc catcgtgggc      2100
     atcattgctg gcctggttct ctttggagct gtgatcactg gagctgtggt cgctgctgtg      2160
     atgtggagga ggaagagctc aggtggggaa ggggtgaagg gtgggtctga gatttcttgt      2220
     ctcactgagg gttccaagac ccaggtagaa gtgtgccctg cctcgttact gggaagcacc      2280
     acccacaatt atgggcctac ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa      2340
     agcacctgtt aaaatgaagg acagatttat caccttgatt acagcggtga tgggacctga      2400
     tcccagcagt cacaagtcac aggggaaggt ccctgaggac cttcaggagg gcggttggtc      2460
     caggacccac acctgctttc ttcatgtttc ctgatcccgc cctgggtctg cagtcacaca      2520
     tttctggaaa cttctctgag gtccaagact tggaggttcc tctaggacct taaggccctg      2580
     actcctttct ggtatctcac aggacatttt cttcccacag atagaaaagg agggagctac      2640
     tctcaggctg caagtaagta tgaaggaggc tgatgcctga ggtccttggg atattgtgtt      2700
     tgggagccca tgggggagct cacccacccc acaattcctc ctctagccac atcttctgtg      2760
     ggatctgacc aggttctgtt tttgttctac cccaggcagt gacagtgccc agggctctga      2820
     tgtgtctctc acagcttgta aaggtgagag cctggagggc ctgatgtgtg ttgggtgttg      2880
     ggcggaacag tggacacagc tgtgctatgg ggtttctttc cattggatgt attgagcatg      2940
     cgatgggctg tttaaagtgt gacccctcac tgtgacagat acgaatttgt tcatgaatat      3000
     ttttttctat agtgtgagac agc                                              3023
//