spacer

EBI Dbfetch

ID   AM942742; SV 1; linear; mRNA; STD; INV; 3111 BP.
XX
AC   AM942742;
XX
DT   19-FEB-2009 (Rel. 99, Created)
DT   19-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Isodiametra pulchra mRNA for piwi-like protein 2 (piwi2 gene)
XX
KW   piwi-like protein 2; piwi2 gene.
XX
OS   Isodiametra pulchra
OC   Eukaryota; Metazoa; Xenacoelomorpha; Acoelomorpha; Acoela; Isodiametridae;
OC   Isodiametra.
XX
RN   [1]
RP   1-3111
RA   De Mulder K.;
RT   ;
RL   Submitted (19-FEB-2008) to the INSDC.
RL   De Mulder K., Department of Zoology, University of Innsbruck,
RL   Technickerstrasse 25, 6020 Innsbruck, AUSTRIA.
XX
RN   [2]
RA   De Mulder K., Pfister D., Kuales G., Willems M., Salvenmoser W., Thaler M.,
RA   Borgonie G., Ladurner P.;
RT   "enigmatic acoel flatworms share a stem cell system with Platyhelminthes";
RL   Unpublished.
XX
DR   MD5; 8c1289ecfe761b3471abfccfcd593ac0.
DR   EuropePMC; PMC2806412; 20017953.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3111
FT                   /organism="Isodiametra pulchra"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:504439"
FT   5'UTR           1..296
FT                   /gene="piwi1"
FT   CDS             297..3020
FT                   /transl_table=1
FT                   /gene="piwi2"
FT                   /product="piwi-like protein 2"
FT                   /db_xref="GOA:B9ZU54"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B9ZU54"
FT                   /protein_id="CAQ03960.1"
FT                   /translation="MGSAAAASQPSPAPSEPLLSSSGAQSAGGRGRGRGPSSGSVALSA
FT                   TSQHILELRTESSSSAARPKSATPSPPSGASPVNERGGGDVSSSSRVAAGSRSGRTGAV
FT                   STAQIESLTSDLASQCLEPAEKRGSYGRHISLHTNHLVLEKIGNRDDATYFTMYHVDFS
FT                   PPTDNLNFRHRLLGSHRATIGKFSFDGSVLFTPNPLPCQNGVLRLKANLADDRPFDISL
FT                   KHVRDLGPTDPDTTRIYGTVFQKIMRLLKFENERKSGKSFDTESKVSVSQHNVEIWPGY
FT                   ITSVSPSDGGLRLLCDVSHKVIRTESVLQFMATARRSARDEEHFKKIVAEEIVGTSVLT
FT                   PYNKKTYKIDDIDWQTSPEGCTFETRDGPVNLVQYYKQHYDISIVDRSQPLLVHIDKKR
FT                   RNPEIEPTNIYLVPELCQLTGLSDKMREDFRVMKDVGAHTRVAPRDRLTRMSQFISRVN
FT                   SSPEASEELRAWGLKLANQPLELPARNILNAREDCVFMGPQGSKRVLITDKCDFSNQLT
FT                   ANKCIKNEPLTRWLVIYSGRDQRGFQQLIDAFGRFVPDLLHGTVERPKDVRLDGDRAED
FT                   YIRAIKDHVTTTTNIQIVVCLLPTKVEQKYNAIKRQCCISTPVASQVIISRTLSNDSKR
FT                   KRIVQNIGLQMVAKMGGELWGVQLPTVQQVGRLMVVGIDVYHEAKKRSESWLGVCCSLN
FT                   QHATRYKSSVHKQTPGVELGGFYNVLFQKSLYKYREMNDGELPERILIYRDGVGDGQMR
FT                   LVRETEIPQLISACRAIQPDYCPAFTVVICQKRINQRFFDMRGGDKGNPMPGTIVDTDV
FT                   TRRGFQDFYLVSQHVRQGTVTPTHYVVLRNDPGKRPLDVDCIQKCTFRLTYMYYNWPGS
FT                   VRVPAPCQYAHKLAQLAGLNISGTPSELLSDRLYFI"
FT   3'UTR           3021..3111
FT                   /gene="piwi1"
XX
SQ   Sequence 3111 BP; 715 A; 971 C; 860 G; 565 T; 0 other;
     cgagggataa atatgccgtc actagcggag ctggtggcga tgaagaaagc tgctgcccga        60
     cagcgggaag agcaagaggc tgccgccgcc gtagcccaac cactccaccc cccagcaccc       120
     actgagactc cggggccagc cgcgtgcccg tcgccgcgac ccaccggccg aggccgaggc       180
     atgatggccg caatggccca atccgcctcg gcattcaatc tcgctctcag gcgtcccccg       240
     ctccatctgt gagctccact gccgggacat cctccgtgtc aggccgtgga cgcgggatgg       300
     gttccgccgc cgcggcgagc cagccctcgc ccgccccctc ggagcctctc ctgtcatcat       360
     ccggtgcgca gtctgcgggt ggcagaggca ggggcagggg cccatcctcc ggctcggtcg       420
     ccctctcggc cacctcgcag cacatactgg agctgaggac cgagtcctcc tcgtccgccg       480
     cccggcccaa gagcgccact ccctctcctc cctccggcgc gtcgcccgtc aatgagcgcg       540
     gaggagggga cgtgtcgagc agcagcaggg tcgccgccgg gagcaggtcg ggccgcacag       600
     gggcggtctc caccgcccag atcgaatccc tcaccagcga cctcgcctcc cagtgcctcg       660
     aaccggccga gaagcgcggc tcctacggca ggcacatctc cctccacacc aaccacctcg       720
     tgctggagaa gatcggaaac cgcgacgacg ccacctactt caccatgtac catgtcgatt       780
     tcagccctcc caccgacaac ttgaacttca gacaccgact gctcggctcc catcgagcaa       840
     caattggaaa attctcgttt gacggatcag tccttttcac tcccaatccc cttccatgcc       900
     agaacggagt tctgagactt aaagcgaacc ttgccgacga ccgtccgttc gacatctcgc       960
     tgaagcacgt gcgagacctc ggcccgactg accccgacac cacccgcata tacggcaccg      1020
     tcttccaaaa gatcatgcgg ttgctgaagt tcgagaacga acgcaagtcg ggcaagtcgt      1080
     tcgacacgga gtcgaaagtg agcgtgtccc aacacaacgt ggagatctgg ccggggtaca      1140
     taacttcggt gtcgccatcc gacggcggct tgcgcctctt gtgcgatgtc agtcacaagg      1200
     tgatccgcac cgagtccgtc ctccagttca tggccacggc gcggagaagt gcccgcgacg      1260
     aggagcattt taagaaaata gtcgcggagg agatcgtggg gacgagtgtc ctaaccccat      1320
     acaataagaa gacgtacaag atcgacgata tcgactggca gacgtctccc gaaggatgca      1380
     ctttcgaaac ccgggatggg ccggtcaatc tggtccaata ttacaaacag cattacgata      1440
     tcagcatcgt agatcggagc cagccactcc tcgtccatat tgataagaag agacgaaatc      1500
     ccgaaatcga gcccactaat atttacctgg ttccggagct gtgccagctg accggcctct      1560
     cggacaagat gcgggaggac ttccgagtaa tgaaggatgt tggagctcac acgcgggtgg      1620
     cgccgcgcga ccgactgacc cgcatgagcc aattcatcag tcgagtcaac tcctcccccg      1680
     aggcgtccga ggaactgcga gcttggggcc tcaagctggc caatcagccc ctagagctgc      1740
     cagccagaaa catcctcaac gcgagggaag attgcgtgtt catgggtccg cagggcagca      1800
     agcgggtgct gatcactgat aaatgcgact tcagcaatca gctgacggcg aataaatgca      1860
     tcaagaatga gcccctcacg cgctggctcg tcatctactc gggccgcgac cagcgtgggt      1920
     tccagcagct catcgacgcg ttcggcaggt tcgtgccgga cctgctgcac ggtacggttg      1980
     agcggcccaa ggacgtccgg ttggacgggg accgagccga ggattacatc agggccatca      2040
     aagaccacgt gaccaccacc actaatatcc aaatcgtggt gtgtcttctg ccaacaaaag      2100
     ttgagcagaa gtacaacgca atcaagcgtc agtgttgcat ttccacgccc gtcgcttctc      2160
     aagttatcat ctccagaact ctcagcaacg acagcaagag aaagaggata gtccagaaca      2220
     tcgggctcca aatggtggcc aagatgggcg gagaattgtg gggcgtccaa ttgccaactg      2280
     tgcaacaagt gggacggctc atggtagtgg gcatcgacgt gtaccacgag gcgaagaagc      2340
     ggtcggagag ctggttgggg gtgtgctgct ccctcaacca gcatgccacc cgatacaaat      2400
     cctcagtaca taagcagacc ccaggagtgg agctcggagg cttttataac gtcctctttc      2460
     agaagtccct ctacaaatac agagagatga atgacggtga gctgccggag cgtatattga      2520
     tataccggga tggggtgggc gacgggcaga tgagattggt gcgggagacc gaaatcccgc      2580
     agttgatcag cgcatgccgt gcaattcaac ccgactactg cccagccttc accgtcgtca      2640
     tctgccagaa gcgcatcaat caaaggttct tcgacatgcg gggcggcgac aagggaaacc      2700
     cgatgccggg caccatcgtg gacaccgacg tcaccaggag gggcttccag gacttctacc      2760
     tggtttcgca gcacgtgcgc cagggcaccg ttacccccac ccactacgtc gtcctccgca      2820
     acgacccggg caagcgcccc ctggacgttg actgcatcca gaagtgcacc ttcaggctga      2880
     cgtacatgta ctacaactgg ccggggtctg tgcgcgtgcc cgcgccctgc caatatgcac      2940
     acaaactggc ccagctcgct gggctgaata tctcaggaac tccttcggaa ctgctctccg      3000
     atcgccttta ctttatttag tttatttaga cttcgtctcg agataaccat tgcatgttct      3060
     tgttggaatg aaatttttgt ttatttaaaa aaaaaaaaaa aaaaaaaaaa a               3111
//


spacer
spacer