spacer

EBI Dbfetch

ID   AM942741; SV 1; linear; mRNA; STD; INV; 2770 BP.
XX
AC   AM942741;
XX
DT   19-FEB-2009 (Rel. 99, Created)
DT   19-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Isodiametra pulchra mRNA for piwi-like protein 1 (piwi1 gene)
XX
KW   piwi-like protein 1; piwi1 gene.
XX
OS   Isodiametra pulchra
OC   Eukaryota; Metazoa; Xenacoelomorpha; Acoelomorpha; Acoela; Isodiametridae;
OC   Isodiametra.
XX
RN   [1]
RP   1-2770
RA   De Mulder K.;
RT   ;
RL   Submitted (19-FEB-2008) to the INSDC.
RL   De Mulder K., Department of Zoology, University of Innsbruck,
RL   Technickerstrasse 25, 6020 Innsbruck, AUSTRIA.
XX
RN   [2]
RA   De Mulder K., Pfister D., Kuales G., Willems M., Salvenmoser W., Thaler M.,
RA   Borgonie G., Ladurner P.;
RT   "enigmatic acoel flatworms share a stem cell system with Platyhelminthes";
RL   Unpublished.
XX
DR   MD5; b7e625046c4f60acb1c83ae10bb76cea.
DR   EuropePMC; PMC2676513; 19430533.
DR   EuropePMC; PMC2806412; 20017953.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2770
FT                   /organism="Isodiametra pulchra"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:504439"
FT   5'UTR           <1..12
FT                   /gene="piwi1"
FT   CDS             13..2697
FT                   /transl_table=1
FT                   /gene="piwi1"
FT                   /product="piwi-like protein 1"
FT                   /db_xref="GOA:B9ZU53"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B9ZU53"
FT                   /protein_id="CAQ03959.1"
FT                   /translation="MAGRARGRGRGAPKPAAPAEQPAPAAPTESVSAPRPAAGRARGRG
FT                   APAAPAPAPQVSAPAAAPPAGISRPRGGGEVRSNGVNGLERRVAAMRVDGAGDREERPR
FT                   FINDENVSSGNFDDFKINVDSIKGDRIQLITNAVALYPKEMLNEPAGFLYHVDFTPPVD
FT                   NRRARTAMVRSKKELLGGPEILFDGGSALFTSKKIGAGEMIEFDVIREYDKSTIRVSLS
FT                   LKNPIFVGHGEFNRISGILMKRALDKVGLTQLGRHHFYPEKKRPLKDGYELWPGFITGV
FT                   NNYDAGLLLVMDTTFKLAHQRTVLMEMNDIYQRMRPRNPEENDRFQREITTQFVGKIIV
FT                   TKYNMKRYRIDDITFDENPLSTFERKTGPVTYKAYYKEHYDENVTDDRQPLLISLPKPR
FT                   DQRRGMDQPILLIPELCYITGISDELRNDNRFMLEMGKITRTGPLEKANTMIELVNGFK
FT                   SKQEVKDSFDFWNMRLDRGLVQMTGIKLHPAEVHFQQRADYNTATADFQGCLRNAKFRV
FT                   PINVQKYCILFTGQNSQNAQKLVEGLGRAGRGFGMNFGECKPIALQSNRIEDLIAQLRN
FT                   VHSETQGLQLAIVVLPDNRADRYNAIKRQCYVETPVPSQCVLNRTLNNEKGFMSVVSKL
FT                   ALQINVKMGGEPWMCKLPVDPGAMIIGMDVHHVGKGGKGPSQLGFVSSLNVELTRFYSR
FT                   VYNNESNEISGTIKVAFVAALQRFHSIHKKYPRDIFIFRDGVGEGQLGVVQREEVAVID
FT                   QALRDLECTSRICFVVVSKRIMQRFFGMQRGGQDLANPPPGTVAFDTVTKKDRYDFFLV
FT                   PQSSRQGTVTPTHYNILFDNTLLEHGRLMALAFNLCHMYYNWTGAIRVPNVCQYAHKLA
FT                   FLAGTSLGGGQPNDQLANTLYFL"
FT   3'UTR           2698..>2770
FT                   /gene="piwi1"
XX
SQ   Sequence 2770 BP; 671 A; 768 C; 802 G; 529 T; 0 other;
     ggcacgagga gaatggcagg gcgtgctaga ggcaggggca gaggggctcc gaagccagct        60
     gcgcccgcgg agcagcccgc acctgctgca ccaactgagt ccgtgtctgc tccgcgtccg       120
     gcggcgggca gagctagagg gagaggagca cccgctgctc cagcccctgc accccaggtt       180
     tctgcacccg ctgcagcgcc cccggctggc atttccaggc ctagaggagg cggtgaagtg       240
     agaagcaacg gagtgaatgg tctggagagg agagtagccg ccatgagggt ggacggagcg       300
     ggtgaccgcg aagaacgccc gagatttatc aacgatgaga acgtgtccag tggaaacttc       360
     gatgacttca agatcaatgt ggactccatc aagggagatc gcattcaact gattacgaac       420
     gccgtggcgc tctatccgaa ggagatgctg aacgagccgg ctggattcct ctatcacgtg       480
     gatttcacgc ctccggtaga caacagaagg gccagaacgg ccatggttcg cagcaagaag       540
     gaacttcttg gaggcccgga gattctgttc gacggcggga gcgctttgtt caccagcaag       600
     aagattggag ccggtgagat gatcgagttt gatgtgatca gggagtacga taagtccact       660
     atccgtgtct cgctctctct caagaacccc atcttcgtgg gtcatggaga gttcaaccga       720
     atctccggta tcttgatgaa gagggccctg gataaagttg ggctaaccca gctgggtcgt       780
     catcacttct acccggagaa gaaacggccg ctgaaagacg ggtacgagtt gtggcctggg       840
     ttcatcaccg gtgtcaacaa ctacgacgcc ggccttctgt tggtgatgga tactactttc       900
     aagctggctc atcagaggac ggtgctgatg gagatgaatg acatctacca acgcatgcgt       960
     ccccgcaacc ccgaggagaa cgaccgcttc caacgggaga tcaccaccca gtttgtgggc      1020
     aagatcatag tcaccaagta caacatgaag aggtaccgaa tcgacgatat caccttcgac      1080
     gagaaccctc tgtccacgtt cgagaggaaa accggccccg tcacttacaa ggcgtattac      1140
     aaggaacatt acgacgagaa cgtgacggat gaccgacagc ctctgctcat ctcgctgccg      1200
     aagccgaggg accagagacg agggatggac caacccattc tgttgatccc tgagctctgc      1260
     tacatcaccg gaatctcgga cgagctccgc aacgacaacc gcttcatgct ggagatgggc      1320
     aagatcaccc gaacggggcc tctcgagaag gccaacacca tgatcgaatt ggtcaacggg      1380
     ttcaagtcca agcaggaagt caaggattct ttcgacttct ggaacatgag actggatcga      1440
     ggactggtgc agatgactgg aatcaaactg catcctgctg aagtgcactt ccagcagaga      1500
     gccgattaca acacagccac tgccgacttc cagggatgtc tgcggaatgc caagttccga      1560
     gtgccaatca acgtgcagaa atactgcatc ctcttcaccg ggcagaattc tcagaatgcg      1620
     cagaagctgg tggaaggact gggcagagcc ggacggggat tcggcatgaa tttcggggag      1680
     tgcaagccga tcgcgctgca gtccaaccgc atcgaggacc tcatcgccca actgcggaat      1740
     gtgcacagcg agacgcaggg tctccaactt gccatcgttg ttctgccgga caaccgcgcc      1800
     gatcggtaca acgccatcaa gagacagtgt tacgtggaga cgccagtgcc gagccagtgt      1860
     gtgctcaaca gaaccctcaa caacgagaag ggcttcatgt ctgtggtgag caagctggcc      1920
     ctgcagatca acgtgaagat gggcggagaa ccctggatgt gcaagctgcc agtggaccct      1980
     ggagccatga tcatcggcat ggacgtgcat catgtgggca aagggggcaa aggcccgtct      2040
     caactcggct tcgtgtcatc gctcaacgtg gagctgacac gattctactc ccgcgtgtac      2100
     aacaatgaga gcaatgaaat ctccggcacc atcaaggtgg cgttcgtagc ggcgttgcag      2160
     agattccact cgattcacaa gaagtaccct cgggacatct tcatcttccg agacggcgtt      2220
     ggtgaaggtc agctgggcgt ggtccaacgg gaggaggtcg ctgttatcga tcaggctctg      2280
     cgggatctag agtgcaccag tcggatctgc ttcgtcgtcg tatccaagag aatcatgcag      2340
     cgcttcttcg gcatgcagcg aggaggccaa gatcttgcca acccgcctcc gggcaccgtc      2400
     gctttcgaca cggtcacaaa gaaggaccgt tacgacttct tcctcgtgcc tcagagctca      2460
     cgccaaggaa ctgtcacccc gacccattac aacatcctgt tcgacaacac tctgctggag      2520
     cacggcagac tgatggccct agctttcaac ctgtgccaca tgtactacaa ctggacaggg      2580
     gcgatccgtg tgcccaacgt gtgccagtac gcacacaagc tggccttcct ggccggaact      2640
     agcctcggtg gagggcagcc caacgatcaa ctagccaaca ccctctactt cctctagatt      2700
     gggtctgggg cgcaatatgc gtgcagtaga gttgtatcgt ctcaaacctt gtgttcttag      2760
     taaaaccgaa                                                             2770
//


spacer
spacer