spacer

EBI Dbfetch

ID   AM934701; SV 1; linear; genomic DNA; STD; HUM; 1696 BP.
XX
AC   AM934701;
XX
DT   25-JAN-2008 (Rel. 94, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*07 allele,
DE   exon 1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1696
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (18-JAN-2008) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01334.x.
RX   PUBMED; 19744147.
RA   Anholts J.D., Aneq M., Dirks H.L., Tas A., Verduyn W., Oudshoorn M.;
RT   "Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1";
RL   Tissue Antigens 74(5):424-428(2009).
XX
DR   MD5; 8ec4ff4fe765dcae8adfdc69fe253f92.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1696
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..73,174..443,544..819,920..1195,1296..1415,
FT                   1516..1548,1649..>1696)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B0JF23"
FT                   /db_xref="IMGT/HLA:C*07:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0JF23"
FT                   /protein_id="CAP72284.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCK"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=1
FT   intron          74..173
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=1
FT   exon            174..443
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=2
FT   intron          444..543
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=2
FT   exon            544..819
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=3
FT   intron          820..919
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=3
FT   exon            920..1195
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=4
FT   intron          1196..1295
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=4
FT   exon            1296..1415
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=5
FT   intron          1416..1515
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=5
FT   exon            1516..1548
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=6
FT   intron          1549..1648
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=6
FT   exon            1649..>1696
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07"
FT                   /number=7
XX
SQ   Sequence 1696 BP; 214 A; 345 C; 367 G; 170 T; 600 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccagagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacaggc tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtctg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg       720
     cccgtgcggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcagn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acccccaaag acacacgtga cccaccaccc cctctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agagcagaga      1140
     tacacgtgcc atatgcagca cgaggggctg caagagcccc tcaccctgag ctgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagc ccaccatccc      1320
     catcatgggc atcgttgctg gcctggctgt cctggttgtc ctagctgtcc ttggagctgt      1380
     ggtcaccgct atgatgtgta ggaggaagag ctcagnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnngtgga aaaggaggga gctgctctca ggctgcgtnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnngc agcaacagtg cccagggctc tgatgagtct      1680
     ctcatcactt gtaaag                                                      1696
//


spacer
spacer