Dbfetch

ID   AM931296; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM931296;
XX
DT   04-MAR-2008 (Rel. 95, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*010101TM allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tavoularis S.;
RT   ;
RL   Submitted (04-JAN-2008) to the INSDC.
RL   Tavoularis S., HLA Laboratory, Canadian Blood Services, Head Office, K1G
RL   4J5, Ontario, CANADA.
XX
RN   [2]
RA   Tavoularis S., Rebeiro E., Sayer D.;
RT   "Identification of two novel DRB1 alleles";
RL   Unpublished.
XX
DR   MD5; 58e7dc476738a1b22d2f09bce0252ca4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010101TM"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B1GVZ9"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B1GVZ9"
FT                   /protein_id="CAP62575.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*010101TM"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 61 C; 99 G; 52 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataatcaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//