Dbfetch

ID   AM931006; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM931006;
XX
DT   19-MAR-2008 (Rel. 95, Created)
DT   09-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*111101TS allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tavoularis S.;
RT   ;
RL   Submitted (19-DEC-2007) to the INSDC.
RL   Tavoularis S., HLA Laboratory, Canadian Blood Services, Head Office, K1G
RL   4J5, Ontario K1G 4J5, CANADA.
XX
RN   [2]
RA   Tavoularis S., Ribeiro E., Sayer D.;
RT   "Identification of two Novel DRB1 alleles";
RL   Tissue Antigens 71(4):197-197(2008).
XX
DR   MD5; c013f08b1938b86cbea6db961cf813a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada"
FT                   /tissue_type="Blood cell"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111101TS"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B1GVZ5"
FT                   /db_xref="IMGT/HLA:DRB1*11:68"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B1GVZ5"
FT                   /protein_id="CAP60696.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111101TS"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//