spacer

EBI Dbfetch

ID   AM922196; SV 1; linear; genomic DNA; STD; HUM; 2811 BP.
XX
AC   AM922196;
XX
DT   12-DEC-2007 (Rel. 94, Created)
DT   01-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*44variant
DE   allele, exons 1-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2811
RA   Dunn P.P.;
RT   ;
RL   Submitted (09-DEC-2007) to the INSDC.
RL   Dunn P.P., Tissue Typing, New Zealand Blood Service, 71 Great South Road,
RL   Epsom, Auckland 1142, NEW ZEALAND.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01122.x.
RX   PUBMED; 18764811.
RA   Hammond L., Dunn P.P.;
RT   "A novel HLA-B*44 allele, HLA-B*4459, identified in a renal patient with
RT   aberrant B44 serology and characterized by sequence-based typing";
RL   Tissue Antigens 72(5):494-495(2008).
XX
DR   MD5; 0f8f1b3fe694fdb790d497b3fd7493a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2811
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(301..373,503..772,1016..1291,1868..2143,2254..>2370)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /product="HLA B44"
FT                   /db_xref="GOA:A9JPE8"
FT                   /db_xref="IMGT/HLA:B*44:59:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A9JPE8"
FT                   /protein_id="CAP58275.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALKEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            <301..373
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=1
FT   intron          374..502
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=2
FT   intron          773..1015
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=2
FT   exon            1016..1291
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=3
FT   intron          1292..1867
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=3
FT   exon            1868..2143
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=4
FT   intron          2144..2253
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=4
FT   exon            2254..2370
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=5
FT   intron          2370..2811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44variant"
FT                   /number=5
XX
SQ   Sequence 2811 BP; 524 A; 848 C; 891 G; 548 T; 0 other;
     ggtgtaggag aagagggatc aggacgaagt cccaggtccc ggacggggct ctcagggtct        60
     caggctccga gggccgcgtc tgcaatgggg aggcgcagcg ttggggattc cccactccca       120
     cgagtttcac ttcttctccc aacctatgtc gggtccttct tccaggatac tcgtgacgcg       180
     tccccatttc ccactcccat tgggtgtcgg gtgtctagag aagccaatca gtgtcgccgg       240
     ggtcccagtt ctaaagtccc cacgcaccca cccggactca gaatctcctc agacgccgag       300
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc       360
     gagacctggg ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagagag       420
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       600
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       660
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       720
     taccgagaga acctgcgcac cgcgctccgc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc       900
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       960
     tggtcggggc ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct      1020
     cacatcatcc agaggatgta cggctgcgac gtggggccgg acgggcgcct cctccgcggg      1080
     tatgaccagg acgcctacga cggcaaggat tacatcgccc tgaaggagga cctgagctcc      1140
     tggaccgcgg cggacaccgc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg      1200
     gcggagcagg acagagccta cctggagggc ctgtgcgtgg agtcgctccg cagatacctg      1260
     gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca      1320
     tctcctatag gtcgccgggg atggcctccc acgagaagag gaggaaaatg ggatcagcgc      1380
     tagaatgtcg ccctcccttg aatggagaat ggcatgagtt ttcctgagtt tcctctgagg      1440
     gccccctctt ctctctagga caattaaggg atgacgtctc tgaggaaatg gaggggaaga      1500
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1560
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1620
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1680
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1740
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtc ccatgagaga tgacaaagcg cctgaatttt ctgactcttc      1860
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggtcacc      1920
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1980
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      2040
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      2100
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      2160
     gggtcatatc tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct      2220
     tcccttcctt cccagaggcc cttcctttcc cagagccgtc ttcccagtcc accgtcccca      2280
     tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga gctgtggtcg      2340
     ctgctgtgat gtgtaggagg aagagctcag gtagggaagg ggtgaggggt ggggtctggg      2400
     ttttcttgtc ccactggggg tttcaagccc caggtagaag tgttccctgc ctcattactg      2460
     ggaagcagca tccacacagg ggctaacgca gcctgggacc ctgtgtgcca gcacttactc      2520
     ttttgtgcag cacatgtgac aatgaaggac ggatgtatca ccttggtggt tgtggtgttg      2580
     gggtcctgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg      2640
     agggcagttg gtccaggacc cacacttgct ttcctcgtgt ttcctgatcc tgccttgggt      2700
     ctgtagtcat acttctggaa attccttttg ggtccaagac gaggaggttc ctctaagatc      2760
     tcatggccct gcttcctccc agtcccctca cagggcattt tcttcccaca g               2811
//


spacer
spacer