spacer

EBI Dbfetch

ID   AM922105; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM922105;
XX
DT   07-DEC-2007 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*55new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Emmerich F.;
RT   ;
RL   Submitted (06-DEC-2007) to the INSDC.
RL   Emmerich F., Transfusion Medicine, Charite University Hospital,
RL   Augustenburger Platz 1, 13353 Berlin, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01030.x.
RX   PUBMED; 18346031.
RA   Emmerich F., Schoenemann C., Galicki L., Salama A.;
RT   "Identification of a novel HLA-B allele, HLA-B*5529, by haplotype-specific
RT   sequencing";
RL   Tissue Antigens 71(5):486-486(2008).
XX
RN   [3]
RP   1-646
RA   Emmerich F.;
RT   ;
RL   Submitted (19-DEC-2007) to the INSDC.
RL   Emmerich F., Transfusion Medicine, Charite University Hospital,
RL   Augustenburger Platz 1, 13353 Berlin, GERMANY.
XX
DR   MD5; 6df5271f2c9f442620f03e8feecb128c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A9JPE7"
FT                   /db_xref="IMGT/HLA:B*55:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A9JPE7"
FT                   /protein_id="CAP57997.2"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAVDTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 167 C; 195 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggtggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer