spacer

EBI Dbfetch

ID   AM921684; SV 1; linear; genomic DNA; STD; ENV; 521 BP.
XX
AC   AM921684;
XX
DT   05-DEC-2007 (Rel. 94, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Uncultured archaeon partial mcrA gene for methyl-coenzyme M reductase
DE   subunit A , clone DC_clone-mcrA-4
XX
KW   .
XX
OS   uncultured archaeon
OC   Archaea; environmental samples.
XX
RN   [1]
RP   1-521
RA   Scanlan P.D.;
RT   ;
RL   Submitted (03-DEC-2007) to the INSDC.
RL   Scanlan P.D., Microbiology Department, University College Cork, Cork City,
RL   IRELAND.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-8-79.
RX   PUBMED; 18492229.
RA   Scanlan P.D., Shanahan F., Marchesi J.R.;
RT   "Human methanogen diversity and incidence in healthy and diseased colonic
RT   groups using mcrA gene analysis";
RL   BMC Microbiol. 8:79-79(2008).
XX
DR   MD5; 6f458b5716ff8e18d52f0aefb0a707e4.
DR   EuropePMC; PMC2408590; 18492229.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..521
FT                   /organism="uncultured archaeon"
FT                   /host="Homo sapiens"
FT                   /environmental_sample
FT                   /mol_type="genomic DNA"
FT                   /country="Ireland"
FT                   /isolation_source="host faeces"
FT                   /clone_lib="mcrA gene clone library from healthy
FT                   individuals"
FT                   /clone="DC_clone-mcrA-4"
FT                   /db_xref="taxon:115547"
FT   CDS             complement(<1..>521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /product="methyl-coenzyme M reductase subunit A"
FT                   /db_xref="GOA:A9JQR1"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR022681"
FT                   /db_xref="UniProtKB/TrEMBL:A9JQR1"
FT                   /protein_id="CAP53918.1"
FT                   /translation="MADICQSSRVNADDPVRSTSDVVALGAALYDQIWLGSYMSGGVGF
FT                   TQYATAAYTDDVLDDFTYYGKDYVEDKYGGLTEAPNNMDTVLDVGSEVSFYALEQYEEY
FT                   PALLETHFGGSQRASVISAAAGCSTAFATGNAQTGLSAWYLGMYLHKEQHSRLGFYGYD
FT                   LQDQCGAANV"
XX
SQ   Sequence 521 BP; 163 A; 109 C; 97 G; 152 T; 0 other;
     aatacgttag ctgcaccaca ttgatcttgt aaatcgtatc cgtagaaacc taatctggaa        60
     tgttgttctt tgtgtaagta catacctaag taccatgcac ttaaaccagt ttgagcatta       120
     ccagtagcga atgcagtgga acaaccagct gctgctgaaa taacagaagc cctttgagat       180
     ccaccgaagt gagtttcaag taaagctggg tattcttcgt attgttctaa tgcgtagaat       240
     gaaacttcag aacctacatc aagaacagta tccatgttgt taggtgcttc agttaatcca       300
     ccatatttgt cttctacata atctttacca tagtaagtga agtcatctaa tacatcatca       360
     gtatatgctg cagtagcata ttgagtgaat cctacaccac cagacatgta agaacctaac       420
     caaatttggt cgtataatgc agcacctaaa gctactacat ctgaggttga acgtactggg       480
     tcgtcagcat ttactctgga agattgacag atatctgcca t                           521
//


spacer
spacer