spacer

EBI Dbfetch

ID   AM921681; SV 1; linear; genomic DNA; STD; ENV; 521 BP.
XX
AC   AM921681;
XX
DT   05-DEC-2007 (Rel. 94, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Uncultured archaeon partial mcrA gene for methyl-coenzyme M reductase
DE   subunit A, clone DC_clone-mcrA-1
XX
KW   .
XX
OS   uncultured archaeon
OC   Archaea; environmental samples.
XX
RN   [1]
RP   1-521
RA   Scanlan P.D.;
RT   ;
RL   Submitted (03-DEC-2007) to the INSDC.
RL   Scanlan P.D., Microbiology Department, University College Cork, Cork City,
RL   IRELAND.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-8-79.
RX   PUBMED; 18492229.
RA   Scanlan P.D., Shanahan F., Marchesi J.R.;
RT   "Human methanogen diversity and incidence in healthy and diseased colonic
RT   groups using mcrA gene analysis";
RL   BMC Microbiol. 8:79-79(2008).
XX
DR   MD5; b46531cb13bb8d47f0893392a2a14d25.
DR   EuropePMC; PMC2408590; 18492229.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..521
FT                   /organism="uncultured archaeon"
FT                   /host="Homo sapiens"
FT                   /environmental_sample
FT                   /mol_type="genomic DNA"
FT                   /country="Ireland"
FT                   /isolation_source="host faecal sample"
FT                   /clone_lib="mcrA gene clone library from Ulcerative colitis
FT                   individuals"
FT                   /clone="DC_clone-mcrA-1"
FT                   /db_xref="taxon:115547"
FT   CDS             complement(<1..>521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /product="methyl-coenzyme M reductase subunit A"
FT                   /db_xref="GOA:A9JQQ9"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR022681"
FT                   /db_xref="UniProtKB/TrEMBL:A9JQQ9"
FT                   /protein_id="CAP53915.1"
FT                   /translation="LADMVQSTREYPDDPARAALETVALGAIIFDQFYLGSYMSGGVGF
FT                   TQYATAAYTDNILEDYVYWAVDLIKSQYGGLCKSKPSMDLLEKLGTEVNTYALEMYEKY
FT                   PAAMESHFGGSQRATVAAASTGIACAMATGNADFGVNGWYLSMLQHKERHGRLGFYGYD
FT                   LQDQCGSANS"
XX
SQ   Sequence 521 BP; 136 A; 121 C; 128 G; 136 T; 0 other;
     aatgagttag cagaaccgca ctgatcctgt aagtcgtatc catagaatcc gagacgtccg        60
     tgcctttctt tatgctggag catagagagg taccatccgt ttacaccgaa gtcggcgttt       120
     ccggttgcca ttgcacaagc gataccggtt gaagcggctg caactgtagc acgctgggat       180
     ccaccgaagt gagattccat agctgcagga tatttctcat acatctcaag agcgtatgtg       240
     ttaacctcag taccgagttt ctctaagaga tccattgaag gtttgctctt gcagagaccg       300
     ccgtactggg atttgattaa gtcaacagcc cagtagacat agtcttcaag gatgttatct       360
     gtgtatgctg cagtagcgta ctgtgtgaat ccgacaccac cagacatgta tgatccaagg       420
     taaaactgat cgaagatgat tgcaccgaga gctacagttt caagagctgc tcttgcaggg       480
     tcatctgggt attcccttgt agactgaacc atatcagcga g                           521
//


spacer
spacer