spacer

EBI Dbfetch

ID   AM921680; SV 1; linear; genomic DNA; STD; ENV; 522 BP.
XX
AC   AM921680;
XX
DT   05-DEC-2007 (Rel. 94, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Uncultured archaeon partial mcrA gene for methyl-coenzyme M reductase
DE   subunit A
XX
KW   .
XX
OS   uncultured archaeon
OC   Archaea; environmental samples.
XX
RN   [1]
RP   1-522
RA   Scanlan P.D.;
RT   ;
RL   Submitted (04-DEC-2007) to the INSDC.
RL   Scanlan P.D., Microbiology Department, University College Cork, Cork City,
RL   IRELAND.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-8-79.
RX   PUBMED; 18492229.
RA   Scanlan P.D., Shanahan F., Marchesi J.R.;
RT   "Human methanogen diversity and incidence in healthy and diseased colonic
RT   groups using mcrA gene analysis";
RL   BMC Microbiol. 8:79-79(2008).
XX
DR   MD5; 2a3b9513507e867bd8197cceae215ed2.
DR   EuropePMC; PMC2408590; 18492229.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..522
FT                   /organism="uncultured archaeon"
FT                   /host="Homo sapiens"
FT                   /environmental_sample
FT                   /mol_type="genomic DNA"
FT                   /country="Ireland"
FT                   /isolation_source="host faeces"
FT                   /clone_lib="human faecal DNA library"
FT                   /db_xref="taxon:115547"
FT   CDS             <1..>522
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /product="methyl-coenzyme M reductase subunit A"
FT                   /db_xref="GOA:A9IVI5"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR022681"
FT                   /db_xref="UniProtKB/TrEMBL:A9IVI5"
FT                   /protein_id="CAP53914.1"
FT                   /translation="MADICQGSRVYPDDPVRSTLEVVALGAALYDQIWLGSYMSGGVGF
FT                   TQYATAAYTDDVLDDFTYYGKDYVEDKYGGLTEAPNNMDTVLDVGSEVAFYALEQYEEY
FT                   PALLETHFGGSQRASVISAAAGASTAFATGNAQTGLSAWYLAMYLHKEQHSRLGFYGYD
FT                   LQDQCGAANV"
XX
SQ   Sequence 522 BP; 152 A; 106 C; 109 G; 155 T; 0 other;
     catggcagat atctgtcaag gttccagagt ttaccctgat gaccctgtac gttccacttt        60
     agaagtagta gcattaggtg ctgcacttta cgaccaaatc tggttaggtt cttacatgtc       120
     tggtggtgta ggattcaccc aatatgctac tgcagcatat actgatgatg tattagatga       180
     ctttacttac tatggtaaag actatgtaga agacaaatat ggcggattaa ctgaagcacc       240
     taacaacatg gacactgttc ttgatgtagg ttctgaagtt gcattctacg cattagaaca       300
     atacgaagaa tacccagcat tacttgaaac tcacttcggt ggatctcaaa gagcttccgt       360
     aatttccgca gcagctggtg catctactgc attcgctact ggtaatgctc aaactggttt       420
     aagcgcatgg tacttagcta tgtacttaca caaagaacaa cattccagat taggattcta       480
     cggttacgat ttacaagatc aatgtggtgc agctaacgta tt                          522
//


spacer
spacer