spacer

EBI Dbfetch

ID   AM910981; SV 1; linear; genomic DNA; STD; ROD; 593 BP.
XX
AC   AM910981;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Tokudaia osimensis partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Tokudaia osimensis (Amami-oshima island spiny rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Tokudaia.
XX
RN   [1]
RP   1-593
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 65ea50410c80c0bfcffff3874c3607a6.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..593
FT                   /organism="Tokudaia osimensis"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Amani Island"
FT                   /collected_by="K. Tsuchiya"
FT                   /tissue_lib="T-898"
FT                   /db_xref="taxon:73109"
FT   CDS             <1..>593
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERS3"
FT                   /protein_id="CAP45648.1"
FT                   /translation="LDQKNLKNLPYDASLGSLHPSITLTVEDKPQPLLSSETESTHQLA
FT                   STPMSSPMSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQDSAYF
FT                   CESDAKKCIAVAPCMEATSCVKPSFNQEDIYITTESLTTTARMSEAADSVPDAEMPVPD
FT                   YTTVHTVQSPRGLILNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 593 BP; 156 A; 174 C; 131 G; 132 T; 0 other;
     gccttgacca gaagaatctg aagaacttgc cttatgatgc ttcccttggc tctctgcacc        60
     cctccattac gctgacagtg gaagacaagc cacagccact tttgagcagt gaaactgagt       120
     ccactcacca acttgcctct acaccgatga gcagtcccat gtcactggca aacattgact       180
     tttatgccca agtaagcgac attacaccag caggtggtgt agtcctttcc ccaggccaaa       240
     agattaaggc aggaatagcc cagggcaaca cccagccgga agtagccacg ccctgccaag       300
     acagtgccta cttctgtgag tcagatgcca aaaagtgcat cgctgtggcc ccttgcatgg       360
     aggccacgtc atgtgtaaaa ccaagcttta accaagagga catttacatc accacagaaa       420
     gccttaccac tactgcccgg atgtccgagg cagcagatag tgttccggat gctgagatgc       480
     ctgtcccaga ctacaccacg gttcacactg tgcagtctcc aaggggcctt atactcaatg       540
     cgactgcttt gcctttgcct gacaaaaaga agtttctctc ctcatgtggc tat              593
//


spacer
spacer