spacer

EBI Dbfetch

ID   AM910980; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910980;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Grammomys macmillani partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Grammomys macmillani (Macmillan's thicket rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Grammomys.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 93ca797f47add55d69e7a1d8ef423562.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Grammomys macmillani"
FT                   /mol_type="genomic DNA"
FT                   /country="Central African Republic"
FT                   /collected_by="L.Granjon"
FT                   /tissue_lib="T-1092"
FT                   /db_xref="taxon:248794"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERS2"
FT                   /protein_id="CAP45647.1"
FT                   /translation="GIHDHYKPDFYNDDSWVEFIELDIDDADEKTEGSDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDSDFHTSDMRDSTSEFAQPQKLNAEADLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTGEDKPRPLLGSETESTHQLTSTPMSNPVPLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNSQPEVATPCQENDSMNSAYFCESDAKKCIAVAPC
FT                   MEAMSCVKPSFNQEDIYITTESLTTTPRMSETADAAPDAEMPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 244 A; 250 C; 207 G; 203 T; 0 other;
     aggcattcat gatcactaca aacccgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagctagat attgatgacg cagatgagaa gactgaaggc tcagacacag acagacttct       120
     aagcgatgac catgagaaat cagccggtat ccttggagca aaagatgatg attctggccg       180
     taccagctgt tatgaccctg acattttgga ttctgatttc cacaccagtg acatgcgtga       240
     tagtacctcg gagtttgctc agccacagaa gttaaatgcg gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga attcgcctta tgatgcttcc cttggctccc tgcacccctc       360
     cattaccctg acaggggaag ataagccacg gccacttctg ggcagtgaaa ctgagtcaac       420
     ccaccaactc acctctacac cgatgagcaa tcccgtgcca ctggcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttccccag gccaaaagat       540
     taaggcaggg atagcccagg gcaactccca gccggaggtg gccacaccct gccaagagaa       600
     tgacagcatg aacagtgcct acttctgtga gtcagatgcc aagaagtgca tcgctgtggc       660
     cccttgcatg gaggccatgt catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactccccg gatgtccgag acagcagatg cggctcctga       780
     tgctgagatg cctgtcccag actacaccac agttcacacc gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcgtgtgg       900
     ctac                                                                    904
//


spacer
spacer