spacer

EBI Dbfetch

ID   AM910977; SV 1; linear; genomic DNA; STD; ROD; 916 BP.
XX
AC   AM910977;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Stenocephalemys albipes partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Stenocephalemys albipes (White-footed Stenocephalemys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Stenocephalemys.
XX
RN   [1]
RP   1-916
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 742275ceb8a99b64402d060c407cc547.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..916
FT                   /organism="Stenocephalemys albipes"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="MAL1"
FT                   /db_xref="taxon:485440"
FT   CDS             <1..>916
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR9"
FT                   /protein_id="CAP45644.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADVDEKTEGSDTDRLLSDD
FT                   HEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDVCDGTSEFAQPQKLKEEADLLCLDQ
FT                   KNLKNSPYEASLDSLHPSITLTVEDKPQPLLGSETESTHQLASTPMSNPTSLANIDFYA
FT                   QVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIAVA
FT                   PRMXATSCVKPSFNQEDIYITTESLTTTARMSETAHXAPDAEMPVPDYTTVHTVQSPRG
FT                   LILNATALPLPLPDKKKFLSSCGY"
XX
SQ   Sequence 916 BP; 253 A; 244 C; 208 G; 209 T; 2 other;
     aggcattcat gataactaca aacctgactt ctacaatgat gattcttggg ttgagttcat        60
     tgagctagat attgatgacg cagatgtgga tgagaagact gaagggtccg acacagacag       120
     acttctaagc gatgaccatg agaaatcagc cggtatcctt ggagcaaagg atgatgattc       180
     tggacgtacc agctgttatg accctgacat tttggatact gatttccaca ccagtgacgt       240
     atgtgatggt acctcggagt ttgctcagcc acagaagtta aaagaggaag ctgatctctt       300
     gtgccttgac cagaagaatc tgaagaactc gccttatgag gcttcccttg actctctgca       360
     cccctccatt accttgacag tggaagacaa gccacagcca cttctgggca gtgaaactga       420
     gtcaacccac caactcgcct ctacaccgat gagcaatccc acgtcactgg caaacattga       480
     cttttatgcc caagtaagtg acattacacc agcaggtggt gtagtccttt ccccaggcca       540
     aaagattaag gcagggatag cccagggcaa cacccagccg gaggtggcca caccctgcca       600
     agaaaattac agcatgaaca gtgcctactt ctgtgagtca gatgccaaaa agtgcatcgc       660
     tgtggcccca cgcatggang ccacgtcatg tgtaaaacca agctttaacc aagaggacat       720
     ttacatcacc accgaaagcc ttaccactac tgcccggatg tccgagacag cacatantgc       780
     tccagatgct gagatgcctg ttccagacta caccacggtt cacaccgtgc agtctccaag       840
     gggccttata ctcaacgcga ctgctctgcc tttgcctttg cctgacaaaa agaagtttct       900
     gtcctcgtgt ggctat                                                       916
//


spacer
spacer