spacer

EBI Dbfetch

ID   AM910976; SV 1; linear; genomic DNA; STD; ROD; 866 BP.
XX
AC   AM910976;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Rattus rattus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Rattus rattus (black rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-866
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; d8d87d9c63f078899af2f28dcda70e9d.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..866
FT                   /organism="Rattus rattus"
FT                   /mol_type="genomic DNA"
FT                   /country="Pakistan:Islamabad"
FT                   /collected_by="Waheedud Din"
FT                   /tissue_lib="T-660"
FT                   /db_xref="taxon:10117"
FT   CDS             <1..>866
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR8"
FT                   /protein_id="CAP45643.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADEKTEESDTDRLLSDDQE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPQKLKAEADLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTMEDKPQPLLGSETESTHQLVSTPMSNPVSLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGLAQGNTQLEVAAPCQENYSMNSAYFCESDAKKCIAAAPH
FT                   MEATTCVKPSFNQEDIYITTESLTTTARMSETADTAPDAEMPVPDYTTVHTVQSPRGLI
FT                   LNATALP"
XX
SQ   Sequence 866 BP; 242 A; 236 C; 197 G; 191 T; 0 other;
     gggcattcat gataactaca aacccgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagctggat attgatgatg cagatgagaa gactgaagag tcagacaccg acagacttct       120
     aagcgatgac caggagaaat cagctggtat ccttggagca aaggatgacg attctggacg       180
     taccagctgt tatgaccctg acattttgga taccgatttc cacaccagtg acatgtgcga       240
     tggtacctcg gagtttgctc agccgcagaa gttaaaagca gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta tgatgcttcc cttggctctc tgcacccctc       360
     cattaccctg acaatggaag acaaaccaca gccacttctg ggcagtgaaa ctgaatcaac       420
     ccaccaactc gtctctacac caatgagcaa tcccgtgtca ctggcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttctccag gccaaaagat       540
     taaggcgggg ttagcccagg gcaacaccca gctggaggtg gccgcgccct gccaagaaaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tcgctgcggc       660
     ccctcacatg gaggccacga catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactgcccg aatgtctgag acagcagata ccgctccaga       780
     tgctgagatg cctgtcccag actataccac ggttcacacc gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctt                                            866
//


spacer
spacer