Dbfetch

ID   AM910975; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910975;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Pseudomys australis partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Pseudomys australis (plains mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Pseudomys.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 9f5d08f9882677642639a78ba8dd7bd2.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Pseudomys australis"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /collected_by="Watts Ch"
FT                   /tissue_lib="T-526"
FT                   /db_xref="taxon:187268"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR7"
FT                   /protein_id="CAP45642.1"
FT                   /translation="GIQDNYKSDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDLCDGTSEFAQPEMLKSETDLLCLDQKN
FT                   LKNSPYDASLGSLHPSMTLTVEDKPQPLLGRETESTHQLTTTQMSNPASLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNTQLEVATPCQENYSMNSAYFCESDAKKCISVAPR
FT                   IEATSCVKPSFNQEDIYITTESLTTTARMSETAETAPDAETPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 252 A; 243 C; 204 G; 205 T; 0 other;
     aggtatccag gataactaca aatccgactt ctacaacgat gactcctggg ttgaattcat        60
     tgagctagat attgatgacc cggatgagaa gactgaaggg tcagacacag acagacttct       120
     cagtgatgac catgagaaat cagcaggtat ccttggagcg aaggatgatg attctggacg       180
     taccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acctgtgtga       240
     tggtacctcg gagtttgctc agccagagat gttaaaatcg gaaactgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta tgatgcttcc cttggctctc tgcacccctc       360
     catgaccctg acagtggaag acaagccaca accacttctg ggccgtgaaa ctgagtcaac       420
     ccaccaactc accactacac agatgagcaa tcctgcgtca ctggcaaaca ttgactttta       480
     tgcccaagta agtgacatta cacccgcagg tggtgtagtc ctttccccag gccaaaagat       540
     taaggcaggg atagcccagg gcaacaccca gctggaggtg gccacgccct gccaagaaaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tctctgtggc       660
     ccctcgcata gaggccacgt catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactgcccg gatgtctgag acagcagaga ctgctccaga       780
     tgctgagaca cctgtcccag attacaccac ggttcacaca gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcgtgtgg       900
     ctat                                                                    904
//