spacer

EBI Dbfetch

ID   AM910974; SV 1; linear; genomic DNA; STD; ROD; 913 BP.
XX
AC   AM910974;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Praomys tullbergi partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Praomys tullbergi
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
XX
RN   [1]
RP   1-913
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 85a56354f62933321726269022b6af77.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..913
FT                   /organism="Praomys tullbergi"
FT                   /mol_type="genomic DNA"
FT                   /country="Gabon:M'Passa"
FT                   /collected_by="V. Nance"
FT                   /tissue_lib="T-422"
FT                   /db_xref="taxon:209869"
FT   CDS             <1..>913
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR6"
FT                   /protein_id="CAP45641.1"
FT                   /translation="IHDNYKPDFYNDDSWVEFIELDIDDADADEKTEGSDTDRLLSDDH
FT                   EKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDICDGTSEFAQPQKLKAEADLLCLDQK
FT                   NLKNSPYEASLGSPHPSITLTVEDKPQPLLGSETESTHQLASTPMSNPTSLANIDFYAQ
FT                   VSDITPAGGVVLSPGQKIKAGIAXGNTQLEVATPCQENYSMNSAYFCESDAKKCIAVAP
FT                   RMEATSCVKPSFNQEDIYITTESLTTTAGMSETAHIVPDAEMPVPDYTTVHTVQSPRGL
FT                   ILNATALPLPLPDKKKFLSSCGY"
XX
SQ   Sequence 913 BP; 251 A; 247 C; 206 G; 207 T; 2 other;
     cattcatgat aactacaaac ccgacttcta caatgatgat tcttgggttg agttcattga        60
     gctagatatt gatgacgcag atgcggatga gaagactgaa gggtccgaca cagacagact       120
     tctaagcgat gaccatgaga aatcagccgg tatccttgga gcaaaggatg atgattctgg       180
     acgtaccagc tgttatgacc ctgacatttt ggatactgat ttccacacca gtgacatatg       240
     tgatggtacc tcggagtttg ctcagccaca gaagttaaaa gcggaagctg atctcttgtg       300
     ccttgaccag aagaatctga agaactcgcc ttatgaggct tcccttggct ctccacaccc       360
     ctccattacc ctgacagtng aagacaagcc acagccactt ctgggcagtg aaactgagtc       420
     aacccaccaa ctcgcctcta caccgatgag caatcccacg tcactggcaa acattgactt       480
     ttatgcccaa gtaagtgaca tcacaccagc aggtggtgta gtcctttccc caggccaaaa       540
     gattaaggca gggatagccc anggcaacac ccagctggag gtggccacgc cctgccaaga       600
     aaattacagc atgaacagtg cctacttctg tgagtcagat gccaaaaagt gcatcgctgt       660
     ggccccacgc atggaggcca cgtcatgtgt aaaaccaagc tttaaccaag aggacattta       720
     tatcaccacc gaaagcctta ccactactgc cgggatgtcc gagacagcac atattgttcc       780
     agatgctgag atgcctgtcc cagactacac cacggttcac accgtgcagt ctccaagggg       840
     ccttatactc aacgcgactg ctctgccttt gcctttgcct gacaaaaaga agtttctgtc       900
     ctcgtgtggc tat                                                          913
//


spacer
spacer