spacer

EBI Dbfetch

ID   AM910969; SV 1; linear; genomic DNA; STD; ROD; 901 BP.
XX
AC   AM910969;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Niviventer niviventer partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Niviventer niviventer (white-bellied rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Niviventer.
XX
RN   [1]
RP   1-901
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 40073bd7690e4bb6934c494c66e2ff85.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..901
FT                   /organism="Niviventer niviventer"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Cao Phong, Province Hoa, Binh"
FT                   /collected_by="Cao Van Sung"
FT                   /tissue_lib="T-1086"
FT                   /db_xref="taxon:83757"
FT   CDS             <1..>901
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR1"
FT                   /protein_id="CAP45636.1"
FT                   /translation="IHDNYKPDFYNDDSWVEFIELDIDDADEKTEESDTDRLLSDDHEK
FT                   SAGILGAKDDDSGRTSCYDPDILDTDFHTSDMYDGTSEFAQPQKLKAEADLLCLDQKNL
FT                   KNSPYDASLGSLHPSITLTMEDKPQPLLGSETESTHQLASTPMSNPVSLANIDFYAQVS
FT                   DITPAGGVVLSPGQKIKVGLAQANTQLEVAAPCQENYSMNSAYFCESDAKKCIAAAPHM
FT                   EPTTCVKPSFNQEDIYITTESLTTTARMSETADTAPDAEMPVPDYTTVHTVQSPRGLIL
FT                   NATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 901 BP; 254 A; 248 C; 197 G; 202 T; 0 other;
     cattcatgat aactacaaac ccgacttcta caatgatgac tcctgggttg agttcattga        60
     gctggatatt gatgacgcgg atgagaagac tgaagagtca gacacggaca gacttctaag       120
     cgatgaccac gagaaatcag ctggtatcct tggagcaaaa gatgatgatt ctggacgcac       180
     cagctgttat gaccctgaca ttttggatac tgatttccac accagtgaca tgtatgatgg       240
     tacctcagag tttgcccagc cgcagaagtt aaaagcagaa gctgatctct tgtgccttga       300
     ccagaagaat ctgaagaact cgccttatga tgcttccctt ggctctctgc acccctccat       360
     taccctgaca atggaagaca aaccacagcc acttctgggc agtgaaactg agtcaaccca       420
     ccaacttgcc tctacaccaa tgagcaatcc cgtgtcactg gcaaacattg acttttatgc       480
     ccaagtaagc gacattacac cagcaggtgg tgtagtcctt tctccaggcc aaaagattaa       540
     ggtggggtta gcccaggcca acacccaact ggaggtggcc gcgccctgcc aagaaaatta       600
     cagcatgaac agtgcctact tctgtgagtc agatgccaaa aagtgcatcg ctgcggcccc       660
     tcacatggag cccacgacat gtgtaaaacc aagctttaac caagaggaca tttacatcac       720
     cacagaaagc cttaccacta ctgcccgaat gtccgagaca gcagataccg ctccagatgc       780
     tgagatgcct gtcccagact acaccacggt tcacaccgtg cagtctccaa ggggccttat       840
     actcaacgcg actgctttgc ctttgcctga caaaaagaag tttctctcct catgtggcta       900
     t                                                                       901
//


spacer
spacer