spacer

EBI Dbfetch

ID   AM910968; SV 1; linear; genomic DNA; STD; ROD; 915 BP.
XX
AC   AM910968;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Myomyscus yemeni partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Myomyscus yemeni (Yemen white-footed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Myomyscus.
XX
RN   [1]
RP   1-915
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 9fa68b1070c3f075eea1d81f338b6d75.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..915
FT                   /organism="Myomyscus yemeni"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="MYE1"
FT                   /db_xref="taxon:485439"
FT   CDS             <1..>915
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERR0"
FT                   /protein_id="CAP45635.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADVDEKTEGSDTDRLLSDD
FT                   HEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDICDGTSEFAQPQKLKAEADLLCLDQ
FT                   KNLKNSPYEASLGSLHPSITLTVEDKPQXLLGGETESTHQLASTPMNNPTSLANIDFYA
FT                   QVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPSQENYSMNSAYFCESDAKKCIAVA
FT                   PRMEATSCVKPSFNQEDIYITTESLTTTARMSETAHIAPDAEMSVPDYTTVHTVQSPRG
FT                   LXLNATALPLPLPDKKKFLSSCG"
XX
SQ   Sequence 915 BP; 254 A; 244 C; 206 G; 209 T; 2 other;
     aggcattcat gataactaca aacccgactt ctacaatgat gattcttggg ttgagttcat        60
     tgagctagat attgatgatg cagatgtgga tgagaagact gaagggtccg acacggacag       120
     acttctaagc gatgaccatg agaaatcagc cggtatcctt ggagcaaagg atgatgattc       180
     tggacgtacc agctgttatg accctgacat tttggatact gatttccaca ccagtgacat       240
     atgtgatggt acctcggagt ttgctcagcc acagaagtta aaagcagaag ctgatctctt       300
     gtgccttgac cagaagaatc tgaagaactc gccttatgag gcttcccttg gctctcttca       360
     cccctccatt accctgacag tggaagacaa gccacagnca cttctgggcg gtgaaactga       420
     gtcaacccac caactagcct ctacaccgat gaacaatccc acgtcactgg caaatattga       480
     cttttatgcc caagtaagtg acatcacacc agcaggtggt gtagtccttt ccccaggcca       540
     aaagattaag gcagggatag cccagggcaa cacccagccg gaggtggcca caccctccca       600
     agaaaattac agcatgaaca gtgcctactt ctgtgagtca gatgccaaaa agtgcatcgc       660
     tgtggcccca cgcatggagg ctacgtcatg tgtaaaacca agctttaacc aagaggacat       720
     ttacatcacc accgaaagcc ttaccactac tgcccggatg tccgagacag cacatattgc       780
     tccagatgct gagatgtctg tcccagacta caccacggtt cacaccgtgc agtctccaag       840
     gggccttana ctcaacgcaa ctgctctgcc tttgcctttg cctgacaaaa agaagtttct       900
     gtcctcgtgt ggcta                                                        915
//


spacer
spacer